[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50819.1
DDBJ      :             sigma-70 region 2 domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   51->105 1aw8E PDBj 3e-07 18.2 %
:RPS:SCOP  13->93 1rp3A3  a.177.1.1 * 4e-08 21.0 %
:HMM:SCOP  11->96 1rp3A3 a.177.1.1 * 8e-15 29.1 %
:HMM:PFM   28->96 PF04542 * Sigma70_r2 3.6e-08 16.4 67/71  
:HMM:PFM   116->160 PF00816 * Histone_HNS 4.4e-05 31.1 45/93  
:BLT:SWISS 15->234 SIGI_BACSU 9e-36 44.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50819.1 GT:GENE ABO50819.1 GT:PRODUCT sigma-70 region 2 domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2525868..2526620) GB:FROM 2525868 GB:TO 2526620 GB:DIRECTION - GB:PRODUCT sigma-70 region 2 domain protein GB:NOTE PFAM: sigma-70 region 2 domain protein KEGG: dsy:DSY4884 hypothetical protein GB:PROTEIN_ID ABO50819.1 GB:DB_XREF GI:134052848 InterPro:IPR007627 LENGTH 250 SQ:AASEQ MTLEQYTALYLNQARNGDTQVREELLASAKPFIQGTCIKVCNRPLEWGRDDELSIGLMAFNEAIDRFAEEKNIPFLGFARLVIKSRLSDHFRKESRHRHQPLEYQVADHAPVQHETAQAWEKYMQEAEMQERQEEVLEFQKELAQYGISVSELVDASPKHRDSRENLISVARLVAETTSLMEQLLRTGRLPVKELALASGLHRKTLEKGRRYIIAMSILLYHRDRFIYLFSYLKLTGWSEGKGGSNYGKG GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 15->234|SIGI_BACSU|9e-36|44.7|217/251| SEG 125->138|qeaemqerqeevle| RP:PDB:NREP 1 RP:PDB:REP 51->105|1aw8E|3e-07|18.2|55/90| HM:PFM:NREP 2 HM:PFM:REP 28->96|PF04542|3.6e-08|16.4|67/71|Sigma70_r2| HM:PFM:REP 116->160|PF00816|4.4e-05|31.1|45/93|Histone_HNS| RP:SCP:NREP 1 RP:SCP:REP 13->93|1rp3A3|4e-08|21.0|81/87|a.177.1.1| HM:SCP:REP 11->96|1rp3A3|8e-15|29.1|86/87|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| OP:NHOMO 63 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111-1-1111--1111111111-1---------1-------------------------------------------------------------------------------------------1112-------1-11---------8--1--11313111-111211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 37.2 SQ:SECSTR ##########HHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccH##HHHHHHHTccTTcEEEEEETTTccEEEEEcEEEcTTcccEEccGGGGGTccTTccE################################################################################################################################################# DISOP:02AL 1-4,113-118,121-121,243-251| PSIPRED ccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHcccHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccc //