[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50836.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50836.1 GT:GENE ABO50836.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2545088..2545795) GB:FROM 2545088 GB:TO 2545795 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1914 hypothetical protein GB:PROTEIN_ID ABO50836.1 GB:DB_XREF GI:134052865 LENGTH 235 SQ:AASEQ MDNLWLLLLGLLALAVLAFLVFPRNHKTANALKKPELPTREPAEEFAQEISPEIPEVSHQKPVPRMEEDPFIPHYYGVNRLVVMARDPNWLYAYWEVNDQKKREFIHRYGEENWLTSRQVLRIYDVTGLNKYERGGHSYQEISLDPFADNWFIEIGQPERTFFLELGRVLLDGRYILLLTSNMVTTPRASVSERFDEQWMWIEEMYLNKEKLSYGFSSAMLVGKGLEPLETSCKI GT:EXON 1|1-235:0| TM:NTM 1 TM:REGION 4->24| SEG 4->20|lwllllgllalavlafl| OP:NHOMO 51 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111-1-----1-------------------------------1------------11------1----------------------------------------------------------------------------------------------1-------------111-----------11--111-1--1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------11-111-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,37-68,235-236| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccEEEEEEEccHHHHHHHHHHccHHHHccccEEEEEEEEccccccccccccEEEEEccccccccEEEcccccccEEEEEEEEccccEEEEEEEccEEEEccccccccccccEEEHHHHHHHHHHHcccccccccccccccccHHcccc //