[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50837.1
DDBJ      :             Abortive infection protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   133->221 PF02517 * Abi 6e-06 40.4 %
:HMM:PFM   132->219 PF02517 * Abi 2.2e-17 31.8 88/99  
:HMM:PFM   1->22 PF06341 * DUF1056 6.8e-05 52.4 21/63  
:BLT:SWISS 111->210 YPRA_ECOLX 3e-07 29.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50837.1 GT:GENE ABO50837.1 GT:PRODUCT Abortive infection protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2545988..2546665 GB:FROM 2545988 GB:TO 2546665 GB:DIRECTION + GB:PRODUCT Abortive infection protein GB:NOTE PFAM: Abortive infection protein KEGG: mta:Moth_1913 abortive infection protein GB:PROTEIN_ID ABO50837.1 GB:DB_XREF GI:134052866 InterPro:IPR003675 LENGTH 225 SQ:AASEQ MIFKKISQNIWGISDVIWVFLLRLMFVYLFSKIVLPLISGISPRLVEILDRVILLSLTFYFVSRKSSIDKLGFHFNHLGRQVLYGVIGGGFLFALAEGTQRALVAFLVADISTNPLVKAAAGAKNFSDLLWPLLIAGLLVPFTEEVYYRGMALRAFANRWGWFLGIIISALFFSLAHLSGIWFVQIAAVGVGLAVIYSITGSLLPGIIAHGLVNSSRLLMVYFSS GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 111->210|YPRA_ECOLX|3e-07|29.0|100/217| TM:NTM 5 TM:REGION 9->31| TM:REGION 42->63| TM:REGION 125->146| TM:REGION 161->183| TM:REGION 192->214| RP:PFM:NREP 1 RP:PFM:REP 133->221|PF02517|6e-06|40.4|89/97|Abi| HM:PFM:NREP 2 HM:PFM:REP 132->219|PF02517|2.2e-17|31.8|88/99|Abi| HM:PFM:REP 1->22|PF06341|6.8e-05|52.4|21/63|DUF1056| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02517|IPR003675| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1--11-11---11-1-----1-111--1---1------1-----------111111---1-1--1------11-------------------------------------------------------------------------------------------------------------------------------------------11-1-1-111--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHc //