[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50855.1
DDBJ      :             Pyrrolo-quinoline quinone
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.4b.70.1
:390 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->333 3hxjA PDBj 7e-13 24.4 %
:RPS:PDB   178->321 1e2rB PDBj 3e-09 6.6 %
:RPS:SCOP  239->331 1s4uX  b.69.4.1 * 3e-06 10.2 %
:HMM:SCOP  29->390 1kv9A2 b.70.1.1 * 2.9e-28 20.0 %
:RPS:PFM   243->316 PF01921 * tRNA-synt_1f 9e-04 37.3 %
:BLT:SWISS 140->362 YXAL_BACSU 4e-08 27.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50855.1 GT:GENE ABO50855.1 GT:PRODUCT Pyrrolo-quinoline quinone GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2563652..2564824) GB:FROM 2563652 GB:TO 2564824 GB:DIRECTION - GB:PRODUCT Pyrrolo-quinoline quinone GB:NOTE SMART: Pyrrolo-quinoline quinone KEGG: swo:Swol_1743 hypothetical protein GB:PROTEIN_ID ABO50855.1 GB:DB_XREF GI:134052884 InterPro:IPR002372 LENGTH 390 SQ:AASEQ MKKLNVILLMILAFFTVIFQAEAAGRLYPYGEVKWMVEKAGKLSADVTITDNGLLYCPAGNKIICYDLSKGTKLWERKMDMGGKITQPLLVQNQIIYATGTEGIQQMRPNGSVTWLYRLLPKAKGSKSSAAVSAGPNNLIYLGVADGLYALEPLKSHKWRYSDEKNILALQGNEQAVYVCLGDKDKGYSLQAIDKQGAKLWQESLGTIKNIHMTFGSEGNLIVVTNPAALDRNTSAKIRCYDPKKGREEWSYSVKTQDITDISFSNDNTIFFCGNSRLYCLNGDNGQLKWDIPLLNVASGVAVDPSKKRIYAGSTDGRIFCVSFAGRLLWDKEIDKTTGQTLAKGGGIMVDTGKDEKDTITRAPILLKDGSILIYTDKGTMYRFVDVFKG GT:EXON 1|1-390:0| BL:SWS:NREP 1 BL:SWS:REP 140->362|YXAL_BACSU|4e-08|27.4|212/410| TM:NTM 1 TM:REGION 4->26| SEG 122->135|kakgskssaavsag| BL:PDB:NREP 1 BL:PDB:REP 34->333|3hxjA|7e-13|24.4|271/305| RP:PDB:NREP 1 RP:PDB:REP 178->321|1e2rB|3e-09|6.6|137/543| RP:PFM:NREP 1 RP:PFM:REP 243->316|PF01921|9e-04|37.3|67/354|tRNA-synt_1f| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01921|IPR002904| GO:PFM GO:0004824|"GO:lysine-tRNA ligase activity"|PF01921|IPR002904| GO:PFM GO:0005524|"GO:ATP binding"|PF01921|IPR002904| GO:PFM GO:0005737|"GO:cytoplasm"|PF01921|IPR002904| GO:PFM GO:0006412|"GO:translation"|PF01921|IPR002904| GO:PFM GO:0006430|"GO:lysyl-tRNA aminoacylation"|PF01921|IPR002904| RP:SCP:NREP 1 RP:SCP:REP 239->331|1s4uX|3e-06|10.2|88/356|b.69.4.1| HM:SCP:REP 29->390|1kv9A2|2.9e-28|20.0|295/0|b.70.1.1|1/1|Quinoprotein alcohol dehydrogenase-like| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN --------------------------------------11111-------12---------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 86.9 SQ:SECSTR ################################cccTTTcccccccccEEcTTccEEcccTTTTTEEEcTTccEEEccc###GGGEEEcEETTTTEEccccccEEEEEcccGGGGGGcccccEEEEcTTTcccccccccEEEEEETTccEEEcTTccEEEETTTTEEEEEEccccccEHHHHHHcHHHHHHHHHHccTTTcccHHHHccccHHHHHHHHHHHHccccTcccccTccccccHHHHHHHcEEcccGGGccccccccccGGGEEEEEEGTEEEEEETTTccEEEEEEccccEEEEEEcTTccEEEEEETTcEEEETcEEEEEEEEEcTTTccEEEEEEEEcccEEEEEEEEEcEEEE#ccccccEEEEE############### DISOP:02AL 1-3| PSIPRED cccccEEEEEEEccccEEEEEccccEEEEccEEEEEEEccccEEEEEEEEcccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEEEcccEEEEEccccEEEEcccccEEEEEEcccccccEEEEEEEEEEcccEEEEEccccEEEEcccccEEEEEEcccccEEEEEccccEEEEEccccccEEEEEEcccccEEEEEccccccEEEEEEccccEEEEEccccEEEEEEccEEEEEEcccccEEEEEEcccccEEEEEEEcccEEEEEEccEEEEEEccccEEEEEEEccccEEEEEEEEEccEEEEEEcccEEEEEEccccEEEEEEcccccEEEEEEEccEEEEEEEcccccEEEEEEEEcccEEEEEEEccEEEEEEEcccc //