[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50859.1
DDBJ      :             phosphoribosyl-ATP pyrophosphatase / phosphoribosyl-AMP cyclohydrolase
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  706/915 : Eukaryota  72/199 : Viruses  0/175   --->[See Alignment]
a.204.1b.168.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->123 1zpsB PDBj 3e-27 50.9 %
:BLT:PDB   142->224 1yvwA PDBj 2e-12 43.9 %
:RPS:PDB   137->224 2a7wA PDBj 4e-26 33.3 %
:RPS:SCOP  3->123 1zpsA1  b.168.1.1 * 4e-43 47.5 %
:RPS:SCOP  140->225 1yvwA1  a.204.1.4 * 1e-29 48.8 %
:HMM:SCOP  2->124 1zpsA1 b.168.1.1 * 5.5e-42 49.2 %
:HMM:SCOP  137->226 2a7wA1 a.204.1.4 * 1.3e-25 50.0 %
:RPS:PFM   30->105 PF01502 * PRA-CH 3e-24 61.3 %
:RPS:PFM   149->224 PF01503 * PRA-PH 1e-16 62.2 %
:HMM:PFM   30->105 PF01502 * PRA-CH 1.4e-37 58.7 75/75  
:HMM:PFM   141->224 PF01503 * PRA-PH 2.8e-16 29.1 79/83  
:HMM:PFM   9->43 PF11580 * DUF3239 0.00017 28.6 35/128  
:BLT:SWISS 4->226 HIS2_THETN 6e-58 54.7 %
:PROS 1->118|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50859.1 GT:GENE ABO50859.1 GT:PRODUCT phosphoribosyl-ATP pyrophosphatase / phosphoribosyl-AMP cyclohydrolase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2570530..2571210) GB:FROM 2570530 GB:TO 2571210 GB:DIRECTION - GB:PRODUCT phosphoribosyl-ATP pyrophosphatase / phosphoribosyl-AMP cyclohydrolase GB:NOTE PFAM: phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP pyrophosphohydrolase KEGG: swo:Swol_1764 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein GB:PROTEIN_ID ABO50859.1 GB:DB_XREF GI:134052888 InterPro:IPR002496 InterPro:IPR008179 InterPro:IPR010916 LENGTH 226 SQ:AASEQ MQFDKEVLKYNEAGLIPAIVQDVHTKEVLMMAWMNQEAVEKTQASGETWFYSRSRQRMWKKGETSGHVQRVKGLYYDCDADTLLVLVEQVGGAACHEGYTSCFHNKINQDNTVIVEGEKKFDPAAVYGNTTETVGAEIIQQLFQVILSRKEDRPEGSYTTYLFEKGVDKICKKIGEEAAEVIIGAKNSQEELTYEAADLIYHLLVLLANQGVSTQEVYRELAKRRK GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 4->226|HIS2_THETN|6e-58|54.7|201/205| PROS 1->118|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 2 BL:PDB:REP 11->123|1zpsB|3e-27|50.9|112/128| BL:PDB:REP 142->224|1yvwA|2e-12|43.9|82/90| RP:PDB:NREP 1 RP:PDB:REP 137->224|2a7wA|4e-26|33.3|87/88| RP:PFM:NREP 2 RP:PFM:REP 30->105|PF01502|3e-24|61.3|75/75|PRA-CH| RP:PFM:REP 149->224|PF01503|1e-16|62.2|74/85|PRA-PH| HM:PFM:NREP 3 HM:PFM:REP 30->105|PF01502|1.4e-37|58.7|75/75|PRA-CH| HM:PFM:REP 141->224|PF01503|2.8e-16|29.1|79/83|PRA-PH| HM:PFM:REP 9->43|PF11580|0.00017|28.6|35/128|DUF3239| GO:PFM:NREP 4 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01502|IPR002496| GO:PFM GO:0004635|"GO:phosphoribosyl-AMP cyclohydrolase activity"|PF01502|IPR002496| GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01503|IPR008179| GO:PFM GO:0004636|"GO:phosphoribosyl-ATP diphosphatase activity"|PF01503|IPR008179| RP:SCP:NREP 2 RP:SCP:REP 3->123|1zpsA1|4e-43|47.5|120/124|b.168.1.1| RP:SCP:REP 140->225|1yvwA1|1e-29|48.8|86/92|a.204.1.4| HM:SCP:REP 2->124|1zpsA1|5.5e-42|49.2|122/0|b.168.1.1|1/1|HisI-like| HM:SCP:REP 137->226|2a7wA1|1.3e-25|50.0|90/0|a.204.1.4|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 1115 OP:NHOMOORG 833 OP:PATTERN ---2--2222222222-1111111222222212222221212222222122222-1-111-1----11 1111121222212111111-11112111111211111211111111212111111111--111221111111111111--11111111111111-----1-111111111---------------111111111111111111111221111111111111111111211211111111111111111111111-22122222222222111111222111112222222211-11111111111111111-1----22-2---22--22----2-111-------212------------------------2----2----11-2222--2-2-1211222---111--1111111112111111111--11121111-----112321122223211111111111111111111111-2112222222122221111211112112222222222222222-----------------------------12221222222222222222222222222222222222221222222222122212242222212222222222222-1111111111111-222222222----111111111111111-1-------11111111112221111111111111111111111111--212211111111111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-1-----111122322111111-11-----1111111111122222223233222222221--------211111111111111111111111111112221222222--------------------------------------1--1-111111 ------1-----11--1--11111211----------111111-11-1------111------11-1--1-11-1111111--111---11-1111111-11-1-1---------------------------------------------------------------------21118111111111-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 95.6 SQ:SECSTR ##########TTEEEEEEEEEETTTccEEEEEEEcHHHHHHHHHHTTcccccccccccHHHHHHHHHHHHHHHHTTcHHHcEEEEHHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHccccccTTccccTccHHHHHHHHHHGGGccTTTcHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHcHH DISOP:02AL 1-1,225-227| PSIPRED ccccHHHHcccccccEEEEEEEcccccEEEEEEEcHHHHHHHHHccEEEEEEcccccccccccccccEEEEEEEEEcccccEEEEEEEEccccccccccccccccccccccEEEEccccccccHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcc //