[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50868.1
DDBJ      :             regulatory protein, LuxR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:483 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   414->468 1fseE PDBj 3e-08 43.6 %
:RPS:PDB   405->466 3cloA PDBj 2e-14 35.5 %
:RPS:SCOP  413->466 1p4wA  a.4.6.2 * 6e-12 33.3 %
:HMM:SCOP  392->471 1p4wA_ a.4.6.2 * 2.1e-14 35.0 %
:RPS:PFM   412->465 PF00196 * GerE 1e-07 46.3 %
:HMM:PFM   413->465 PF00196 * GerE 1.9e-15 43.4 53/58  
:BLT:SWISS 414->468 GERE_BACSU 9e-08 43.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50868.1 GT:GENE ABO50868.1 GT:PRODUCT regulatory protein, LuxR GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2581009..2582460 GB:FROM 2581009 GB:TO 2582460 GB:DIRECTION + GB:PRODUCT regulatory protein, LuxR GB:NOTE PFAM: regulatory protein, LuxR KEGG: aeh:Mlg_2151 two component transcriptional regulator, LuxR family GB:PROTEIN_ID ABO50868.1 GB:DB_XREF GI:134052897 InterPro:IPR000792 LENGTH 483 SQ:AASEQ MIRNKLKSILYMPQWVAHSASLILIFGWILIYPMHGFLLHYLFGSNAYLLGHVFTASHGLGLVALGLLPIYVLRNTLLVKLAGFAIFIFTFIWTILPVNSYIQYSICTLLGFISAYLVLIWACGFHFNKYPELTVGFAMAFTNIILGLVVFEYTQPETLPKVITSLTGLGPLFGAFYLARPKPIAEPQLILEEPGKNKTIMYTFLGIAILSSFAYFSGGLWYRAVLPLFYLKMPELIGIESFVYALSVLILAFFSNKYSFYWVGTIGLSMLGVGLATSISGLESSIEVTITLSFLAIGFGAIDLFYWLILRKLSTFLGYQKAFGLGLGLSLFFITAPGIAIDTGILKNPLLNPVLSIIGACLLFLINPLLVYLLRSLSLFSASEKILATLTDKLTATRDDQIPTAKLPEYFIRLTKAEKKVYDLICKGHTDVEIASSLFISRHTVKFHARNIFKKAGVSNRKELLANLSGNRDEDKRYPSGKC GT:EXON 1|1-483:0| BL:SWS:NREP 1 BL:SWS:REP 414->468|GERE_BACSU|9e-08|43.6|55/74| TM:NTM 11 TM:REGION 14->36| TM:REGION 62->84| TM:REGION 105->126| TM:REGION 132->154| TM:REGION 159->180| TM:REGION 203->225| TM:REGION 235->256| TM:REGION 259->281| TM:REGION 287->309| TM:REGION 323->345| TM:REGION 355->377| SEG 84->95|faififtfiwti| SEG 323->333|fglglglslff| SEG 369->381|llvyllrslslfs| BL:PDB:NREP 1 BL:PDB:REP 414->468|1fseE|3e-08|43.6|55/64| RP:PDB:NREP 1 RP:PDB:REP 405->466|3cloA|2e-14|35.5|62/249| RP:PFM:NREP 1 RP:PFM:REP 412->465|PF00196|1e-07|46.3|54/57|GerE| HM:PFM:NREP 1 HM:PFM:REP 413->465|PF00196|1.9e-15|43.4|53/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 1 RP:SCP:REP 413->466|1p4wA|6e-12|33.3|54/87|a.4.6.2| HM:SCP:REP 392->471|1p4wA_|2.1e-14|35.0|80/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 15.3 SQ:SECSTR ##############################################################################################################################################################################################################################################################################################################################################################################################################THHHHHccHHHHTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHHT########### DISOP:02AL 1-4,394-413,474-484| PSIPRED ccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHcccccccEEHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHccHHcccccHHEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccc //