[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50873.1
DDBJ      :             phosphoribosylglycinamide formyltransferase
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  818/915 : Eukaryota  170/199 : Viruses  1/175   --->[See Alignment]
c.65.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->202 2ywrA PDBj 4e-57 50.8 %
:RPS:PDB   2->197 3dcjB PDBj 4e-52 43.8 %
:RPS:SCOP  4->201 1c2tA  c.65.1.1 * 8e-70 40.9 %
:HMM:SCOP  4->198 1meoA_ c.65.1.1 * 1.4e-67 47.2 %
:RPS:PFM   4->184 PF00551 * Formyl_trans_N 2e-41 48.0 %
:HMM:PFM   5->184 PF00551 * Formyl_trans_N 8.3e-60 43.9 180/181  
:BLT:SWISS 5->190 PUR2_DROME 8e-48 47.8 %
:PROS 136->159|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50873.1 GT:GENE ABO50873.1 GT:PRODUCT phosphoribosylglycinamide formyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2587203..2587814) GB:FROM 2587203 GB:TO 2587814 GB:DIRECTION - GB:PRODUCT phosphoribosylglycinamide formyltransferase GB:NOTE TIGRFAM: phosphoribosylglycinamide formyltransferase PFAM: formyl transferase domain protein KEGG: pca:Pcar_1292 phosphoribosylglycinamide formyltransferase GB:PROTEIN_ID ABO50873.1 GB:DB_XREF GI:134052902 InterPro:IPR001555 InterPro:IPR002376 InterPro:IPR004607 LENGTH 203 SQ:AASEQ MNKLRIGVLASGRGSNLQSILDRCQEGTVAAEVVVVISDKPAAYALERARQAGITAFGLEIRSFPGKREYEQAVVKLLQDAGVELVCLAGYMRLVGESLLRAFPNRIMNIHPALLPSFTGLHGQRDALQYGVKISGCTVHFVDEGMDTGPIILQAAVPVLDDDTEESLSARILNQEHRIYPEAVKLFAEGRLQVVGRKVYIKK GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 5->190|PUR2_DROME|8e-48|47.8|186/1353| PROS 136->159|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 4->202|2ywrA|4e-57|50.8|197/213| RP:PDB:NREP 1 RP:PDB:REP 2->197|3dcjB|4e-52|43.8|194/205| RP:PFM:NREP 1 RP:PFM:REP 4->184|PF00551|2e-41|48.0|179/179|Formyl_trans_N| HM:PFM:NREP 1 HM:PFM:REP 5->184|PF00551|8.3e-60|43.9|180/181|Formyl_trans_N| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| RP:SCP:NREP 1 RP:SCP:REP 4->201|1c2tA|8e-70|40.9|198/210|c.65.1.1| HM:SCP:REP 4->198|1meoA_|1.4e-67|47.2|195/205|c.65.1.1|1/1|Formyltransferase| OP:NHOMO 1811 OP:NHOMOORG 1017 OP:PATTERN ------------------11111-22222222-----------1111111221--------111--22 1221211233311131122-221122222221211122332221222122224443221112322542222-------111113111111321111---11213222212---------------22122222212111111111222222222222222222222222212213222222223333321122211111111111111122222211122212111111112211111111111111-1111211-11111-1-1111111111111111111111111111111111111111111111111121111111121111222111112111111111112212112111212311212221121121322311211112221222223222222222222-21111111211254423453345432222213222211122222222222212221121111111---------------111112232122422333333433333334333323333243212224422222222223222111221111111211222121213111323321112111111333312232122222222212111111122222122222225132322222222222222122221-12212------22222222222222222-2222222222222222222222222222222222222222222222222221-212222222222--21111111111-2333---222-2222222222222231222233333335544332444211112111322232222222222222222222222221111111111--------1---------------------------1111111121121 ----111-----1122222222222221111-11111111--1111-2222222122222221-11111-1111-11-111111-111-1212111----112111-12-21335-41121221221216H2-213111221222111212-1617224215132-111132121122181123244542423221114 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEccccHHHHHHHHHccTTcccEEEEEEEEcccccHHHHHHHHTTccEEEccGGGcccHHHHHHHHHHHHHTTcccEEEEccccccccHHHHHHHTTcEEEEEcccTTccccccHHHHHHHHTccEEEEEEEEEccTTcEEEEEEEEEEEccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEETTEEcccc DISOP:02AL 1-1| PSIPRED ccccEEEEEEccccccHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEcccccccccccHHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEEc //