[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50874.1
DDBJ      :             phosphoribosylformylglycinamidine cyclo-ligase
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  822/915 : Eukaryota  180/199 : Viruses  1/175   --->[See Alignment]
d.139.1d.79.4
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->341 2z01A PDBj e-101 59.5 %
:RPS:PDB   19->342 2btuA PDBj 3e-75 55.8 %
:RPS:SCOP  8->173 1cliA1  d.79.4.1 * 2e-48 58.2 %
:RPS:SCOP  174->342 1cliA2  d.139.1.1 * 5e-37 43.7 %
:HMM:SCOP  7->173 1cliA1 d.79.4.1 * 1.4e-51 47.6 %
:HMM:SCOP  174->348 1cliA2 d.139.1.1 * 1.1e-56 53.2 %
:RPS:PFM   90->145 PF00586 * AIRS 2e-07 51.8 %
:RPS:PFM   179->345 PF02769 * AIRS_C 1e-06 37.7 %
:HMM:PFM   180->342 PF02769 * AIRS_C 1.1e-32 34.1 138/151  
:HMM:PFM   49->145 PF00586 * AIRS 6.8e-24 38.9 90/96  
:BLT:SWISS 11->347 PUR5_BREBN e-115 58.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50874.1 GT:GENE ABO50874.1 GT:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2587839..2588891) GB:FROM 2587839 GB:TO 2588891 GB:DIRECTION - GB:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GB:NOTE KEGG: mta:Moth_2046 phosphoribosylformylglycinamidine cyclo-ligase TIGRFAM: phosphoribosylformylglycinamidine cyclo-ligase PFAM: AIR synthase related protein; AIR synthase related protein domain protein GB:PROTEIN_ID ABO50874.1 GB:DB_XREF GI:134052903 InterPro:IPR000728 InterPro:IPR004733 InterPro:IPR010918 LENGTH 350 SQ:AASEQ MTEQKSQPLTYAGAGVNIEAGNQAVSLMKQAVRSTFRPEVLTDIGGFGGLFALNAGKYKEPVLVSGTDGVGTKLRVAQLTDNHHTIGIDAVAMCVNDILVQGAEPLFFLDYLAVGKLVPERVAEIVKGVAEGCRQAGCALIGGETAEMPGFYAVEEYDIAGFAVGVVERTQLIDGRGIEAGDAVIGLPSSGLHSNGYSLARKALLEVAGYGMTDTVKELGRSVGEELLEPTRIYVKAVQPLLEKFTVKGMAHITGGGLTENIPRMLPEGVKVVLNRSAWPVLPVCQLIQQIGQVAEEEMLRTFNMGIGMVLIVPAAESAAVLQDLASRHEQAYLIGQVESGPSQVEYIQG GT:EXON 1|1-350:0| BL:SWS:NREP 1 BL:SWS:REP 11->347|PUR5_BREBN|e-115|58.5|337/346| SEG 45->56|ggfgglfalnag| BL:PDB:NREP 1 BL:PDB:REP 23->341|2z01A|e-101|59.5|306/313| RP:PDB:NREP 1 RP:PDB:REP 19->342|2btuA|3e-75|55.8|317/322| RP:PFM:NREP 2 RP:PFM:REP 90->145|PF00586|2e-07|51.8|56/97|AIRS| RP:PFM:REP 179->345|PF02769|1e-06|37.7|146/148|AIRS_C| HM:PFM:NREP 2 HM:PFM:REP 180->342|PF02769|1.1e-32|34.1|138/151|AIRS_C| HM:PFM:REP 49->145|PF00586|6.8e-24|38.9|90/96|AIRS| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00586|IPR000728| RP:SCP:NREP 2 RP:SCP:REP 8->173|1cliA1|2e-48|58.2|165/166|d.79.4.1| RP:SCP:REP 174->342|1cliA2|5e-37|43.7|167/175|d.139.1.1| HM:SCP:REP 7->173|1cliA1|1.4e-51|47.6|166/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 174->348|1cliA2|1.1e-56|53.2|173/175|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 1138 OP:NHOMOORG 1064 OP:PATTERN --11--1111111111-11111111111111111121212221111111111111112111111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------1111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111212111111111111111111111111111111111111111111111111121111111---------------1111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111111111111111-12-2121214111111111111391-113-1111-11-1111-111215222253111-111163112111182111121321231121111 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 98.0 SQ:SECSTR #######cTTTccccccTcccHccTTTTTTTTGGGccTTEEcccccEEccTTccTcccccEEEEEEEEEccTTHHHHHHHcccccHHHHHHHHHHHHHHTTTcEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEccTTcccccEEEEEEEEEEEETTcccccTTccTTcEEEEEEccccTTccHHHHHHHHHccccccTTcccccccccHHHHHTccccccHHHHHHHHHHccccccEEccTTHHHHHTGGGccTTEEEEEcTTcccccHHHHHHHHHHTccHHHHTTTccTTEEEEEEEcTTTHHHHHHHHHHHTccEEEEEEEEEccEEEEEETT DISOP:02AL 1-10,344-344| PSIPRED ccccccccccHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccEEEEEEccccccccccHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEcccEEEcccccccccEEEEEEEEEEEcccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHcccEEEEEHHHccccHHHHHHHHHccccHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEcc //