[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50877.1
DDBJ      :             phosphoribosylformylglycinamidine synthase I
Swiss-Prot:             

Homologs  Archaea  59/68 : Bacteria  811/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->225 3d54D PDBj 2e-45 48.8 %
:RPS:PDB   1->226 3d54D PDBj 5e-27 43.2 %
:RPS:SCOP  2->227 1t3tA2  c.23.16.1 * 3e-23 26.2 %
:HMM:SCOP  1->229 1t3tA2 c.23.16.1 * 6.7e-77 49.8 %
:RPS:PFM   43->100 PF07685 * GATase_3 1e-12 63.6 %
:HMM:PFM   39->100 PF01965 * DJ-1_PfpI 1.4e-08 42.1 57/148  
:BLT:SWISS 1->230 PURQ_CARHZ 4e-94 67.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50877.1 GT:GENE ABO50877.1 GT:PRODUCT phosphoribosylformylglycinamidine synthase I GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2592538..2593239) GB:FROM 2592538 GB:TO 2593239 GB:DIRECTION - GB:PRODUCT phosphoribosylformylglycinamidine synthase I GB:NOTE TIGRFAM: phosphoribosylformylglycinamidine synthase I KEGG: chy:CHY_1073 phosphoribosylformylglycinamidine synthase I GB:PROTEIN_ID ABO50877.1 GB:DB_XREF GI:134052906 InterPro:IPR010075 LENGTH 233 SQ:AASEQ MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMSPVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPIAHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEEILGNIDGQLIFKSLLETWQRRCG GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 1->230|PURQ_CARHZ|4e-94|67.2|229/234| BL:PDB:NREP 1 BL:PDB:REP 5->225|3d54D|2e-45|48.8|201/211| RP:PDB:NREP 1 RP:PDB:REP 1->226|3d54D|5e-27|43.2|206/211| RP:PFM:NREP 1 RP:PFM:REP 43->100|PF07685|1e-12|63.6|55/151|GATase_3| HM:PFM:NREP 1 HM:PFM:REP 39->100|PF01965|1.4e-08|42.1|57/148|DJ-1_PfpI| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 1 RP:SCP:REP 2->227|1t3tA2|3e-23|26.2|221/262|c.23.16.1| HM:SCP:REP 1->229|1t3tA2|6.7e-77|49.8|227/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1063 OP:NHOMOORG 1034 OP:PATTERN --11--1-11111111-111111111111111111111111111112111111111111-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1---1-11-11---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111-111111111-1211111111111111111111111111-111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--1111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----111111111111111111111111-1111111111111111111111111111-11-11111111-1111111111-11111121111111111-11-21-1111--1111121111171112211--1-11--1-1-1--1---111--111-1311111111111A11111112111111211-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 100.0 SQ:SECSTR cEEEEEccTTEEEHHHHHHHHHTTTcEEEEEEEcTTcccccccEEEEcEEcGGGGcccTTHHHHTcTTHHHHHHHHHHTcEEEEcHHHHHHHHHTcccccEEEccccccccccEEEEEEcccccTTcTTccTTcEEEEEccccccEEEcccEEEEEcccccEEEEEEccTccEEEEEccccccGGGEEEEEcccccEEEEccccTTTTcTTTTccTTcHHHHHHHHHHHHHHH DISOP:02AL 232-234| PSIPRED cEEEEEEccccccHHHHHHHHHHccccEEEEEEcccccHHHccEEEEcccccccccccHHHHHHHccHHHHHHHHHHccccEEEEcHHHHHHHHcccccccEEEcccccEEccEEEEEEccccccHHcccccccEEEEEEEcccccEEccHHHHHHHHHccEEEEEEEccccccccccccccccccEEEEEcccccEEEEEccHHHHcccccccccHHHHHHHHHHHHHHccc //