[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50882.1
DDBJ      :             Xanthine/uracil/vitamin C permease
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  600/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
d.142.2
:457 amino acids
:PSIPRED
:RPS:SCOP  365->416 1xdnA  d.142.2.4 * 5e-05 30.6 %
:RPS:PFM   16->416 PF00860 * Xan_ur_permease 4e-56 43.2 %
:HMM:PFM   18->415 PF00860 * Xan_ur_permease 1.2e-38 20.9 369/389  
:BLT:SWISS 2->456 Y326_METJA e-105 45.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50882.1 GT:GENE ABO50882.1 GT:PRODUCT Xanthine/uracil/vitamin C permease GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2596391..2597764) GB:FROM 2596391 GB:TO 2597764 GB:DIRECTION - GB:PRODUCT Xanthine/uracil/vitamin C permease GB:NOTE PFAM: Xanthine/uracil/vitamin C permease KEGG: chy:CHY_0697 xanthine/uracil permease family protein GB:PROTEIN_ID ABO50882.1 GB:DB_XREF GI:134052911 InterPro:IPR006043 LENGTH 457 SQ:AASEQ MLEQLFKLKENKTTVRTEVVAGLTTFMTMAYILFLNPNILAGTGMDKNAVFFATAMAGAVVTIAMGLFVNFPIALAPGMGLNAYFAAVAAQGQGMPWETALGAVFISGIIFLILTVTQIRQILMVAIPNSMKRAITVGIGLFITIIGLKLSEVAIVKAGPVIPPTMDALQKGGVATLKFFEWNSFIGSFHNPSMVLTIIGLIITGILMSRGVKGSLLIGIVLTTIIGIPMGVTVIPENFTPFAIPDLSQVYVGKLDIMGAFEMGLWTIVFTFTFVELFDTFGTLVGTAGKAGLLDENGQSPKIGKAMLVDALGVSFGAFMGTSTVTAYVESAAGVGEGGRTGLTAVTTGAMFLLALVIAPLAGLIPNAATAPALIIVGLLMVSAIREIDFDDFTEGFPAFLTFALMPFTYNIANGIAAGIVFYTTLKVASGRAKEVHWMMYLLFVIIVARYLFLGGE GT:EXON 1|1-457:0| BL:SWS:NREP 1 BL:SWS:REP 2->456|Y326_METJA|e-105|45.2|431/436| TM:NTM 13 TM:REGION 21->43| TM:REGION 45->67| TM:REGION 69->90| TM:REGION 103->125| TM:REGION 137->159| TM:REGION 189->211| TM:REGION 214->236| TM:REGION 259->281| TM:REGION 309->331| TM:REGION 342->364| TM:REGION 368->390| TM:REGION 400->422| TM:REGION 435->456| SEG 196->207|ltiigliitgil| SEG 216->228|lligivlttiigi| RP:PFM:NREP 1 RP:PFM:REP 16->416|PF00860|4e-56|43.2|373/381|Xan_ur_permease| HM:PFM:NREP 1 HM:PFM:REP 18->415|PF00860|1.2e-38|20.9|369/389|Xan_ur_permease| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00860|IPR006043| GO:PFM GO:0006810|"GO:transport"|PF00860|IPR006043| GO:PFM GO:0016020|"GO:membrane"|PF00860|IPR006043| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00860|IPR006043| RP:SCP:NREP 1 RP:SCP:REP 365->416|1xdnA|5e-05|30.6|49/265|d.142.2.4| OP:NHOMO 1154 OP:NHOMOORG 699 OP:PATTERN -------1---------1-------11111111--11-11111-----------1111111------- -11-11111111111------1---1------11111111----11111111322111--11111123231111111111111-----------11-----------1-----------------11111111111--------11--11---------------1--1-1-------------11--11--1244444444344444412222244421222233333332211111111111111111111242111113332211114222221111111111111111111111111111111111111111111111111223333333353512114333121111111-11121-11111111131---111--------11---------11121111111-11-11111--1-------1---221------1-------11111111-111-11------------------------------1----1111113333332111122222222123222222--222-----1---1--1-----121111111---------11---1-111--1-1111-111111-----111-1111111-1111111-11-1--3--11-1-1111222212622222242222--1----------22422224554444444-3444444444344444442333221122222222222222222313233321-222222222222---------1111---21222222111-122221112111-111-222222222222221111111111111122311111112321111111----------1------22212-2-1-1----1---------------1----1-11111111-1- --------------11133111111111111211-111211111112322344312222222------------------------11-1-41111------1223--2------------------------------------------------------3---------1--21-----4312353231-1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHcHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccc //