[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50894.1
DDBJ      :             Protein-glutamate O-methyltransferase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  493/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.58.1c.66.1
:256 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->239 1bc5A PDBj 6e-32 37.0 %
:RPS:PDB   3->255 1af7A PDBj 1e-36 33.1 %
:RPS:SCOP  3->65 1af7A1  a.58.1.1 * 3e-13 30.2 %
:RPS:SCOP  67->254 1af7A2  c.66.1.8 * 2e-51 34.4 %
:HMM:SCOP  2->66 1af7A1 a.58.1.1 * 1.2e-12 33.8 %
:HMM:SCOP  67->256 1af7A2 c.66.1.8 * 5.6e-47 35.7 %
:RPS:PFM   3->53 PF03705 * CheR_N 1e-06 37.3 %
:RPS:PFM   67->248 PF01739 * CheR 2e-39 48.6 %
:HMM:PFM   67->240 PF01739 * CheR 1.1e-58 41.4 174/196  
:HMM:PFM   2->54 PF03705 * CheR_N 1.1e-18 32.1 53/57  
:BLT:SWISS 3->255 CHER_BACHD 4e-61 43.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50894.1 GT:GENE ABO50894.1 GT:PRODUCT Protein-glutamate O-methyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2607251..2608021) GB:FROM 2607251 GB:TO 2608021 GB:DIRECTION - GB:PRODUCT Protein-glutamate O-methyltransferase GB:NOTE PFAM: MCP methyltransferase, CheR-type KEGG: mta:Moth_0801 MCP methyltransferase, CheR-type GB:PROTEIN_ID ABO50894.1 GB:DB_XREF GI:134052923 InterPro:IPR000780 LENGTH 256 SQ:AASEQ MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRKK GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 3->255|CHER_BACHD|4e-61|43.9|253/257| BL:PDB:NREP 1 BL:PDB:REP 4->239|1bc5A|6e-32|37.0|230/269| RP:PDB:NREP 1 RP:PDB:REP 3->255|1af7A|1e-36|33.1|248/274| RP:PFM:NREP 2 RP:PFM:REP 3->53|PF03705|1e-06|37.3|51/57|CheR_N| RP:PFM:REP 67->248|PF01739|2e-39|48.6|181/195|CheR| HM:PFM:NREP 2 HM:PFM:REP 67->240|PF01739|1.1e-58|41.4|174/196|CheR| HM:PFM:REP 2->54|PF03705|1.1e-18|32.1|53/57|CheR_N| GO:PFM:NREP 2 GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF03705|IPR000780| GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF01739|IPR000780| RP:SCP:NREP 2 RP:SCP:REP 3->65|1af7A1|3e-13|30.2|63/81|a.58.1.1| RP:SCP:REP 67->254|1af7A2|2e-51|34.4|183/193|c.66.1.8| HM:SCP:REP 2->66|1af7A1|1.2e-12|33.8|65/81|a.58.1.1|1/1|Chemotaxis receptor methyltransferase CheR, N-terminal domain| HM:SCP:REP 67->256|1af7A2|5.6e-47|35.7|185/193|c.66.1.8|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1069 OP:NHOMOORG 523 OP:PATTERN -----------------------11111-111---1--1111133-13-2422-1-1-11-------- 1221-----------11----1---1--------------2---2---1-------------1-1---------------1---12-------------1-1-2-52423-----------------111---21-22222---11112122--------------32231------------2-------211222222221222222111121222111111111111113------------------------------------------------------------------------------------------31123111111111111221---115--11131114213212111221--2124334-----3135631144225----------1-2242244721--1113322223531-211-2-444425---------22211734------------------------------1-211211-12223324222144352223132243422--11231422221421123121242-------1112232822215318633219AA7849255565962-1111-1111-1-1-------21-5---32-224111142222221122212311133---2241------11111111111111111-1111111111111111111---111111111111111111111111-1111--111111111111---1---------22512-----------------------1-1444444335334334444-----1---1111233333111332244444333------621122222222222211--------------------------2-12211111-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 99.6 SQ:SECSTR HHHHHHHHHHHHHHHcccccGGGHHHHHHHHHHHHHHHTcccHHHHHHHHHHcTTcHHHHHHHHccccccTTTTTTHHHHHHHHTHHHHHHccccEEEEEcccTTTHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHTEEEGGGGTTccHHHHHHHEETcccEEEEcHHHHTTEEEEEccTTcccccccEEEEEEcccGGGccHHHHHHHHHHHGGGEEEEEEEEEcTTcccTTTcTETEEEEETTEEEE# PSIPRED ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHcccccHHHHccccHHHHHHHccccccEEEEcHHHHHcccEEccccccccccccccEEEEcHHHHHccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccHHHcccccEEEc //