[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50899.1
DDBJ      :             type IV pilus assembly PilZ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.2
:221 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  99->206 1ywuA1  b.45.2.1 * 2e-08 14.1 %
:HMM:SCOP  128->221 1ylnA1 b.45.2.1 * 5.6e-05 15.9 %
:RPS:PFM   101->210 PF07238 * PilZ 3e-06 29.6 %
:HMM:PFM   99->212 PF07238 * PilZ 2.5e-16 26.5 102/102  
:BLT:SWISS 6->220 YPFA_BACSU 2e-09 20.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50899.1 GT:GENE ABO50899.1 GT:PRODUCT type IV pilus assembly PilZ GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2610965..2611630) GB:FROM 2610965 GB:TO 2611630 GB:DIRECTION - GB:PRODUCT type IV pilus assembly PilZ GB:NOTE PFAM: type IV pilus assembly PilZ KEGG: chy:CHY_1012 putative flagellar protein GB:PROTEIN_ID ABO50899.1 GB:DB_XREF GI:134052928 InterPro:IPR009875 LENGTH 221 SQ:AASEQ MAIERIKVGQKVTIFPMDTEEQYLSSVYDMDNKGIYVPIPYAEKHPLILAHGQQIRVKYMGEGSAYLFVTEAIGRRIEQDKLPMYILKHPKESEITRVQLREFARVPVMLDIEYAEAVADNESPSFKKVCIVDLSGGGLKFALKEPINRGTNIMVRFTLAVKAKKKTQEFKLLARVMRCQLVDEEAKVYHVGVRFTDIRPQQQDMIMAFVFERMIQIKRRQ GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 6->220|YPFA_BACSU|2e-09|20.3|207/217| RP:PFM:NREP 1 RP:PFM:REP 101->210|PF07238|3e-06|29.6|98/102|PilZ| HM:PFM:NREP 1 HM:PFM:REP 99->212|PF07238|2.5e-16|26.5|102/102|PilZ| RP:SCP:NREP 1 RP:SCP:REP 99->206|1ywuA1|2e-08|14.1|92/125|b.45.2.1| HM:SCP:REP 128->221|1ylnA1|5.6e-05|15.9|88/0|b.45.2.1|1/1|PilZ domain-like| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1--1----1-11--1------1-------------------------------------------------------------------------------------------111-11111111111--111----1----111111111--1111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,219-222| PSIPRED cccEEEEcccEEEEEEcccccEEEEEEEEEEccEEEEEccccccEEEEEccccEEEEEEEEccEEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEEccEEEEEEEEccEEEEEccccccccccEEEEEEEEcccEEEEEEccccccccEEEEEEEEccccccccEEEEEEEEEEEEEEccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHcc //