[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50900.1
DDBJ      :             Cobyrinic acid a,c-diamide synthase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  345/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->248 1hyqA PDBj 6e-17 32.2 %
:RPS:PDB   9->248 3ea0A PDBj 5e-26 19.4 %
:RPS:SCOP  13->273 1cp2A  c.37.1.10 * 3e-28 16.4 %
:HMM:SCOP  10->252 1ionA_ c.37.1.10 * 2.5e-48 31.9 %
:RPS:PFM   14->167 PF01656 * CbiA 4e-13 39.7 %
:HMM:PFM   13->222 PF01656 * CbiA 4e-31 30.2 172/194  
:BLT:SWISS 10->268 YLXH_BACSU 2e-38 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50900.1 GT:GENE ABO50900.1 GT:PRODUCT Cobyrinic acid a,c-diamide synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2611643..2612464) GB:FROM 2611643 GB:TO 2612464 GB:DIRECTION - GB:PRODUCT Cobyrinic acid a,c-diamide synthase GB:NOTE PFAM: Cobyrinic acid a,c-diamide synthase KEGG: chy:CHY_1011 putative flagellar biosynthesis protein GB:PROTEIN_ID ABO50900.1 GB:DB_XREF GI:134052929 InterPro:IPR002586 LENGTH 273 SQ:AASEQ MKIVNGHSGARVIAVTSGKGGVGKSNLVVNLAVELTRRDYRVAIFDADLGMANAEVLLGIVPQYTLYDYLFCGKDMAAILTPSPQGVSIISGGSGFVELANLDTQARKRLGQGLEELDYQFDFVLVDTGAGISKTVLGFVAAANEVIVVITPEPTSLTDGYGLIKVLSKYNVHNEVMLVVNKATDEKEALRTFQSMESTTNQFLKIRVKNLGFIPEDKAVVKGVKSQKPYITLSPSAPAAKNLSRIVNCLISGKEEAASGVQSFFGKLMRLFR GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 10->268|YLXH_BACSU|2e-38|32.8|259/298| SEG 88->95|siisggsg| BL:PDB:NREP 1 BL:PDB:REP 11->248|1hyqA|6e-17|32.2|227/232| RP:PDB:NREP 1 RP:PDB:REP 9->248|3ea0A|5e-26|19.4|232/237| RP:PFM:NREP 1 RP:PFM:REP 14->167|PF01656|4e-13|39.7|136/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 13->222|PF01656|4e-31|30.2|172/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 13->273|1cp2A|3e-28|16.4|256/269|c.37.1.10| HM:SCP:REP 10->252|1ionA_|2.5e-48|31.9|232/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 486 OP:NHOMOORG 374 OP:PATTERN -----------------------12111---11-1111122211--2------111-1222--1-1-- ------------------------------------------------1---122--------------------111-----22421-----111----1-------1---------------------------22211---1--11-11---11---11---1--21-111--1111-111-1-----2211111111111111111122121112223111------12----------------------11--1----11-----1---------------------------------------------------11211111111121211111---123--213211122211211222111-11-----------------------------------------------------------1-111------------------1----111--------------------------------1-1----1-11---------------------1111-----111111--1-1121211121-------111--211212143232223111111112111111-121111-1111112222212121222-1111-1211111-1111121111111111111---1112--------------------------------------------------------------------------------------------------1111-11-1---------------11111--1111211112111112111111---------2111111111111221111111112------121111112223333322--------------------------2-21121222--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 100.0 SQ:SECSTR EEccTTccccEEEEEEEccTTccHHHHHHHHHHHTTcTTccEEEEEccTTTccGGGTccccccccHHHHHHTGGGccHHHHHHcEEETTEEEEcccccHHHHHHccHHHHHHHHHHHHHHccEEEEEEEccccTTHHHHGGGccEEEEEEcccHHHHHHHHHHHHHHHTcccccccEEEEEcTTccTTHHccHHHHHHHHTccEHHTcccEEEEcccHHHHHHHHHTccHHHHcTTcHHHHHHHHHHHHHHHccccccccHHHHHHHHHHTTH DISOP:02AL 1-13,253-265| PSIPRED ccccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccHHccccccccHHHHHHccccHHHHcccccccEEEEEcccccccHHHccHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHc //