[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50904.1
DDBJ      :             flagellar biosynthetic protein FliR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  460/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->236 PF01311 * Bac_export_1 3e-30 38.2 %
:HMM:PFM   5->245 PF01311 * Bac_export_1 8e-60 32.1 240/249  
:BLT:SWISS 16->237 FLIR_BACSU 1e-32 32.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50904.1 GT:GENE ABO50904.1 GT:PRODUCT flagellar biosynthetic protein FliR GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2616841..2617608) GB:FROM 2616841 GB:TO 2617608 GB:DIRECTION - GB:PRODUCT flagellar biosynthetic protein FliR GB:NOTE TIGRFAM: flagellar biosynthetic protein FliR PFAM: type III secretion system inner membrane R protein KEGG: mta:Moth_0788 flagellar biosynthetic protein FliR GB:PROTEIN_ID ABO50904.1 GB:DB_XREF GI:134052933 InterPro:IPR002010 InterPro:IPR006303 LENGTH 255 SQ:AASEQ MINLVYVTTFFLVFVRMLSFIFSCPLYAIPGIPPLVKAGLSLVLAALTAPLVEPAAASFPGGLWGLGLAVFSEVGVGLAIGLVCTFVFNAIRIAGQLLDFQIGFAMAAVMDPLGGGMNTLVSRFLFFMTLVLYMNMDGHHALIRALVKSYELVPLTAAAMNGELTLLIIRIFTDTFALAVQICAPVVAVLVITDLAMGLIGKTAPQLNIFQLGFPLKIAVGVSTLAILLPALTSVFKYLFDTLHKDLLLLLKGLA GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 16->237|FLIR_BACSU|1e-32|32.4|219/259| TM:NTM 7 TM:REGION 6->28| TM:REGION 32->54| TM:REGION 65->87| TM:REGION 118->140| TM:REGION 152->174| TM:REGION 180->202| TM:REGION 222->244| SEG 4->15|lvyvttfflvfv| SEG 239->254|lfdtlhkdlllllkgl| RP:PFM:NREP 1 RP:PFM:REP 16->236|PF01311|3e-30|38.2|220/245|Bac_export_1| HM:PFM:NREP 1 HM:PFM:REP 5->245|PF01311|8e-60|32.1|240/249|Bac_export_1| GO:PFM:NREP 2 GO:PFM GO:0006605|"GO:protein targeting"|PF01311|IPR002010| GO:PFM GO:0016020|"GO:membrane"|PF01311|IPR002010| OP:NHOMO 571 OP:NHOMOORG 462 OP:PATTERN -------------------------------------------------------------------- 11--------------------------------------1---1---1----1--------1-1------------------11-11--------------------1-111111111-----1--------------------1---------------------------------------------1111111111111111111111111111--111111111111------------------------------------------------------------------------------------------11111111111111111111---111--11111111111111111111--11111111------211111121121111111-1-1-111111112-11211111111111--1-1---1211-----------111--111--------------------------------11111-112222321111122111112131211111--112112111--121111111131-------111-11111-11111112222111111111----2-1-1111-1111111111111111111---12-111111111312131211121122221---111111-11121-12111221111111-2211221111212-11--1---11-112222222222222222111-11114-233333323333--2------1111--411-------------------------111111111111111-121---------1111111111331111122122223------11111111--------11--------------------------1-11111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 109-117,255-256| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //