[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50909.1
DDBJ      :             flagellar basal body-associated protein FliL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->112 3i79A PDBj 2e-04 36.7 %
:RPS:PFM   3->119 PF03748 * FliL 7e-10 27.4 %
:HMM:PFM   9->119 PF03748 * FliL 1.1e-23 29.9 107/149  
:BLT:SWISS 26->119 FLIL_AQUAE 7e-10 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50909.1 GT:GENE ABO50909.1 GT:PRODUCT flagellar basal body-associated protein FliL GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2619474..2619833) GB:FROM 2619474 GB:TO 2619833 GB:DIRECTION - GB:PRODUCT flagellar basal body-associated protein FliL GB:NOTE PFAM: flagellar basal body-associated protein FliL KEGG: cno:NT01CX_1914 flagellar protein FliL GB:PROTEIN_ID ABO50909.1 GB:DB_XREF GI:134052938 InterPro:IPR005503 LENGTH 119 SQ:AASEQ MKSTANAKGTGPDPEKLVTYSMGSLLVNLADSGGNSFMRLTPVLEYEQNKENKKLGEELTKNKVILQDCIIRVIRKKKLKDVQPPESIDKVAEELKTEINSQLRHGKILRVYFSEYLTQ GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 26->119|FLIL_AQUAE|7e-10|31.1|90/161| BL:PDB:NREP 1 BL:PDB:REP 59->112|3i79A|2e-04|36.7|49/455| RP:PFM:NREP 1 RP:PFM:REP 3->119|PF03748|7e-10|27.4|113/149|FliL| HM:PFM:NREP 1 HM:PFM:REP 9->119|PF03748|1.1e-23|29.9|107/149|FliL| GO:PFM:NREP 3 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF03748|IPR005503| GO:PFM GO:0006935|"GO:chemotaxis"|PF03748|IPR005503| GO:PFM GO:0009425|"GO:bacterial-type flagellum basal body"|PF03748|IPR005503| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111-----111----1-------1--111-1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 41.2 SQ:SECSTR ##########################################################EEEETTTccEEEEEEEETTTccccccHHHHHHHHHHHT#####TcccTTcccEE####### DISOP:02AL 1-11,81-82| PSIPRED ccccccccccccccccEEEEEEccEEEEEEcccccEEEEEEEEEEEccccccHHHHHHHHHccHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcc //