[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50926.1
DDBJ      :             protein of unknown function DUF180
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.158.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->126 2aj7B PDBj 2e-20 37.8 %
:RPS:PDB   7->126 2aj7A PDBj 6e-30 37.8 %
:RPS:SCOP  7->126 2aj7A1  b.158.1.1 * 8e-29 37.5 %
:HMM:SCOP  7->135 2aj7A1 b.158.1.1 * 1.9e-35 36.4 %
:RPS:PFM   7->126 PF02623 * FliW 4e-19 40.0 %
:HMM:PFM   7->126 PF02623 * FliW 2e-40 42.5 120/121  
:BLT:SWISS 7->136 FLIW_CALS8 2e-23 44.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50926.1 GT:GENE ABO50926.1 GT:PRODUCT protein of unknown function DUF180 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2634492..2634902 GB:FROM 2634492 GB:TO 2634902 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF180 GB:NOTE PFAM: protein of unknown function DUF180 KEGG: bha:BH3618 hypothetical protein GB:PROTEIN_ID ABO50926.1 GB:DB_XREF GI:134052955 InterPro:IPR003775 LENGTH 136 SQ:AASEQ MDQPVKILFKNGLPGFETLRYFSISRAFAETEFYYLQSNEETEICFLCINPFHYTKHYEFVVPQPIQEELGIQRLEDVAVFNIVTINGQLDQATVNLQAPLVINVPLRKGMQVVLNDPALNIKESLKSLLQGTVGK GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 7->136|FLIW_CALS8|2e-23|44.2|129/152| BL:PDB:NREP 1 BL:PDB:REP 7->126|2aj7B|2e-20|37.8|119/146| RP:PDB:NREP 1 RP:PDB:REP 7->126|2aj7A|6e-30|37.8|119/155| RP:PFM:NREP 1 RP:PFM:REP 7->126|PF02623|4e-19|40.0|120/121|FliW| HM:PFM:NREP 1 HM:PFM:REP 7->126|PF02623|2e-40|42.5|120/121|FliW| GO:PFM:NREP 2 GO:PFM GO:0009296|"GO:flagellum assembly"|PF02623|IPR003775| GO:PFM GO:0019861|"GO:flagellum"|PF02623|IPR003775| RP:SCP:NREP 1 RP:SCP:REP 7->126|2aj7A1|8e-29|37.5|120/148|b.158.1.1| HM:SCP:REP 7->135|2aj7A1|1.9e-35|36.4|129/0|b.158.1.1|1/1|BH3618-like| OP:NHOMO 91 OP:NHOMOORG 91 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---1111111------11------------------------------------------------------------------------------------------11111111111111111111---111-------111111-1-11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-11-1111-----------------1------1111111-1--1-11--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111--------11--------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 88.2 SQ:SECSTR ######EEcTTccTTcTTccEEEEEEccTTccEEEEEEcccTTcEEEEEcGGGTcTTccccccHHHHHHTTcccGGGEEEEEEEEccccGGGcEEcccccEEEETTTTTEEEcccccccccTTEEc########## DISOP:02AL 1-1,136-137| PSIPRED ccHHHEEEccccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEcHHHHcccccccccHHHHHHccccccccEEEEEEEEEcccHHHHHHHHcccEEEEccccEEEEEEEccccccccccHHHHHHHHHcc //