[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50934.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.32.1
:75 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->62 1io1A  e.32.1.1 * 6e-04 31.0 %
:HMM:PFM   7->73 PF10977 * DUF2797 0.0001 22.7 66/235  
:BLT:SWISS 7->64 ZC3H1_HUMAN 8e-04 32.8 %
:REPEAT 2|1->34|38->74

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50934.1 GT:GENE ABO50934.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2641580..2641807) GB:FROM 2641580 GB:TO 2641807 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50934.1 GB:DB_XREF GI:134052963 LENGTH 75 SQ:AASEQ MTKEELLQDELQRVKFRIQILNMIEDKLREMKALAEQVVRKEIGQEEIANIQFRVNELVNEISSLEKLEEPEVLH GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 7->64|ZC3H1_HUMAN|8e-04|32.8|58/100| NREPEAT 1 REPEAT 2|1->34|38->74| HM:PFM:NREP 1 HM:PFM:REP 7->73|PF10977|0.0001|22.7|66/235|DUF2797| RP:SCP:NREP 1 RP:SCP:REP 21->62|1io1A|6e-04|31.0|42/395|e.32.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,72-76| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccc //