[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50944.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->114 PF03646 * FlaG 2e-05 31.3 %
:HMM:PFM   27->114 PF03646 * FlaG 1.9e-06 29.5 88/108  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50944.1 GT:GENE ABO50944.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2650186..2650539) GB:FROM 2650186 GB:TO 2650539 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50944.1 GB:DB_XREF GI:134052973 LENGTH 117 SQ:AASEQ MKIGAGGLQSIIMSDMMRSLEPTVKPKAGVEETLMQAQGRDQNQLKKELNRAVERLNHLVEALNYPIQIVIKELPPRLRMVLKDKRTGQEKEIEYDELDQLAAHLEDAKGVQLDGYA GT:EXON 1|1-117:0| RP:PFM:NREP 1 RP:PFM:REP 32->114|PF03646|2e-05|31.3|83/113|FlaG| HM:PFM:NREP 1 HM:PFM:REP 27->114|PF03646|1.9e-06|29.5|88/108|FlaG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,34-48,116-118| PSIPRED ccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHccccccccc //