[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50970.1
DDBJ      :             protein of unknown function DUF633
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  201/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->215 3gnlB PDBj 6e-23 31.3 %
:RPS:PDB   4->136 3a25A PDBj 4e-07 13.8 %
:RPS:SCOP  8->137 1f38A  c.66.1.22 * 1e-11 24.4 %
:HMM:SCOP  5->157 1ufkA_ c.66.1.39 * 4.2e-14 24.1 %
:RPS:PFM   21->214 PF04816 * DUF633 2e-36 44.0 %
:HMM:PFM   21->223 PF04816 * DUF633 8.1e-58 42.0 200/205  
:BLT:SWISS 21->159 YQFN_BACSU 3e-22 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50970.1 GT:GENE ABO50970.1 GT:PRODUCT protein of unknown function DUF633 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2676547..2677251) GB:FROM 2676547 GB:TO 2677251 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF633 GB:NOTE PFAM: protein of unknown function DUF633 KEGG: chy:CHY_0459 hypothetical protein GB:PROTEIN_ID ABO50970.1 GB:DB_XREF GI:134052999 InterPro:IPR006901 LENGTH 234 SQ:AASEQ MINLSERLKCLAQFVPNGSVVADIGTDHGYLPTHLVLLGTCPRAIAADINKGPLEAAQSNILQYNVQDKIDLRLGNGLQVLRPGEADVIVIAGMGGGTIRDILEASPEVALQATRFILQPMADEKELRAYLLQHGWTLRDEELLLEDGRLYQVLVAERGQEEIGESILLEIGPRLIEKKHLLLSVHIRRLIEKYQRVLMGLQKSTQEVALRKAEHIKEKIGQLRKIEAELLSSH GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 21->159|YQFN_BACSU|3e-22|38.8|139/216| SEG 138->150|lrdeellledgrl| SEG 161->172|eeigesilleig| BL:PDB:NREP 1 BL:PDB:REP 4->215|3gnlB|6e-23|31.3|211/228| RP:PDB:NREP 1 RP:PDB:REP 4->136|3a25A|4e-07|13.8|130/264| RP:PFM:NREP 1 RP:PFM:REP 21->214|PF04816|2e-36|44.0|191/203|DUF633| HM:PFM:NREP 1 HM:PFM:REP 21->223|PF04816|8.1e-58|42.0|200/205|DUF633| RP:SCP:NREP 1 RP:SCP:REP 8->137|1f38A|1e-11|24.4|127/186|c.66.1.22| HM:SCP:REP 5->157|1ufkA_|4.2e-14|24.1|145/0|c.66.1.39|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 201 OP:NHOMOORG 201 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111-111-----------------------------------------------------------1-1-1---1--1-----1----111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 90.6 SQ:SECSTR ###GHHHHHHHHHHccTTcEEEETTcTTTTTHHHHHHHTcccEEEEEcccHHHHHHHHHHHHHTTcTTTEEEEcccGGGccccccEEEEEEcccccccGGGGHHHHHHHEEEEEEEEEETTTTHHHHHHHHHTTTcEEEEEEEEEETTEEEEEEEEEccccccccHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHH################### DISOP:02AL 1-4,200-214,234-235| PSIPRED cccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEccccccccHHHEEEcHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //