[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50984.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.5.2
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->43 1aipC PDBj 2e-06 34.1 %
:RPS:SCOP  3->54 1aipC1  a.5.2.2 * 1e-05 28.8 %
:HMM:SCOP  1->54 1efuB3 a.5.2.2 * 7e-11 33.3 %
:HMM:PFM   6->36 PF00627 * UBA 3.8e-06 43.3 30/37  
:HMM:PFM   35->69 PF06600 * DUF1140 0.00083 32.4 34/107  
:BLT:SWISS 5->54 EFTS_CYACA 5e-05 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50984.1 GT:GENE ABO50984.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2697117..2697566) GB:FROM 2697117 GB:TO 2697566 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_0602 hypothetical protein GB:PROTEIN_ID ABO50984.1 GB:DB_XREF GI:134053013 LENGTH 149 SQ:AASEQ MTSELEKIDLLRARLGVSYKEAKEALNLADGDVVQALIKLEEKNRHWNEKLHGKGNEFMGQFKTLLEKGQRTKVKIKKDDDTVVEFPATVGALGVLGAMASTPILVVGALGTIAGLVNNYRLEFQEDSDRWEPEVEVPENNFDKNNPQH GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 5->54|EFTS_CYACA|5e-05|36.0|50/208| SEG 72->84|tkvkikkdddtvv| RP:PDB:NREP 1 RP:PDB:REP 3->43|1aipC|2e-06|34.1|41/195| HM:PFM:NREP 2 HM:PFM:REP 6->36|PF00627|3.8e-06|43.3|30/37|UBA| HM:PFM:REP 35->69|PF06600|0.00083|32.4|34/107|DUF1140| RP:SCP:NREP 1 RP:SCP:REP 3->54|1aipC1|1e-05|28.8|52/52|a.5.2.2| HM:SCP:REP 1->54|1efuB3|7e-11|33.3|54/0|a.5.2.2|1/1|UBA-like| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------221---------------111-1--1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 27.5 SQ:SECSTR ##cHHHHHHHHHHHHcccHHHHHHHHHHTTTcHHHHHHHHHHH########################################################################################################## DISOP:02AL 1-2,46-52,138-150| PSIPRED cccHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEcccHHHHHHHHHccHHHHHHHHHHHHHHHHHcEEEEEccccccccEEEccHHHcccccccc //