[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50992.1
DDBJ      :             protein of unknown function UPF0054
Swiss-Prot:Y2482_DESRM  RecName: Full=Putative metalloprotease Dred_2482;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  619/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->129 1oz9A PDBj 2e-18 51.2 %
:RPS:SCOP  38->151 1tviA  d.92.1.15 * 8e-33 34.6 %
:HMM:SCOP  1->153 1xm5A_ d.92.1.15 * 1.8e-43 48.3 %
:RPS:PFM   34->150 PF02130 * UPF0054 2e-21 55.2 %
:HMM:PFM   12->150 PF02130 * UPF0054 2e-50 53.3 137/145  
:BLT:SWISS 1->153 Y2482_DESRM 1e-61 100.0 %
:PROS 119->129|PS01306|UPF0054
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50992.1 GT:GENE ABO50992.1 GT:PRODUCT protein of unknown function UPF0054 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2703008..2703469) GB:FROM 2703008 GB:TO 2703469 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0054 GB:NOTE PFAM: protein of unknown function UPF0054 KEGG: tte:TTE0972 predicted metal-dependent hydrolase GB:PROTEIN_ID ABO50992.1 GB:DB_XREF GI:134053021 InterPro:IPR002036 LENGTH 153 SQ:AASEQ MAVLVNNLQEEISVEENLLKLVESVVKVSLESEGYSPDAEVGLIFVDDNYIRSLNAEYRGIDKATDVLSFALNEGEEMPEEEEAEDLLGDIVISLPTAQRQAAEYGHSFNREVAYLTAHGSLHLLGYDHMTEEDRQVMRQKEEGILERLGINR GT:EXON 1|1-153:0| SW:ID Y2482_DESRM SW:DE RecName: Full=Putative metalloprotease Dred_2482; EC=3.4.24.-; SW:GN OrderedLocusNames=Dred_2482; SW:KW Complete proteome; Hydrolase; Metal-binding; Metalloprotease;Protease; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->153|Y2482_DESRM|1e-61|100.0|153/153| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 119->129|PS01306|UPF0054|PDOC01010| SEG 13->33|sveenllklvesvvkvslese| SEG 74->85|egeempeeeeae| BL:PDB:NREP 1 BL:PDB:REP 38->129|1oz9A|2e-18|51.2|86/141| RP:PFM:NREP 1 RP:PFM:REP 34->150|PF02130|2e-21|55.2|116/142|UPF0054| HM:PFM:NREP 1 HM:PFM:REP 12->150|PF02130|2e-50|53.3|137/145|UPF0054| GO:PFM:NREP 2 GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF02130|IPR002036| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02130|IPR002036| RP:SCP:NREP 1 RP:SCP:REP 38->151|1tviA|8e-33|34.6|104/150|d.92.1.15| HM:SCP:REP 1->153|1xm5A_|1.8e-43|48.3|147/0|d.92.1.15|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 655 OP:NHOMOORG 644 OP:PATTERN -------------------------------------------------------------------- -1---1-1111-1--11-----111------1--------1111---1--------------1-------1-111---111--11111-----------1-1111---1----------------11---11-11-11111111111111--1111111111111111111-1111111-11-111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111111111111111111111111111111111111-----111111111111111111-------------------11--11--1111--1111---111-----1------------------11111--------------------1-11-1-11-11111111111111111111111111111----1--11-11111-1111--111111111111111111111-1-1----------111-111---1------11111111111111111111-11-111-111111111-11111111111111111111-1--11---1111--11-11111111111-1111111111111111111111--1-11111111111111111111111111--11111111111--1----------111-1121111-----1111------1---111111-1111--111111---------111--1111111-111111-11111----111-111111111-1---11111111-11-11--1111-1-11111-111-11111--- ----------------------------------------------------------------------------------------------------------------1-111----------1-311-111----1--------------111------------4--1--1-15-1-1-11-----1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 74.5 SQ:SECSTR ##################################HHccEEEEEEEEcHHHHHHHHHHHHcccccccEEEEEcccEETTEEc#ccccEEEEEEEEHHHHHHHHHHHTccHHHHHHHHHHHHHHHHTTcccccTTccHHHHHHHHHHHHHH#### DISOP:02AL 153-154| PSIPRED cEEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHccccccccEEEccccccccccccccccccccEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccc //