[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51012.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->150 PF11832 * DUF3352 2.5e-05 10.7 103/536  
:BLT:SWISS 36->134 ASNA_LACBA 7e-04 29.2 %
:TM
:REPEAT 2|77->99|101->123

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51012.1 GT:GENE ABO51012.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2724078..2724530) GB:FROM 2724078 GB:TO 2724530 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51012.1 GB:DB_XREF GI:134053041 LENGTH 150 SQ:AASEQ MLRNALLFMLFGAFVLMVGFGVYIANECFNSLILPEQPVQLYSFSQEESGNVRIQVLGETLEVNTVAMQKYAGNLYERVDQNWQAVKNNPQVNEKTIFVIKNIKKQWQDIKNNAQLKEKTIFIKEMAEEKWEAFLASERVKAVNQWVQGQ GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 36->134|ASNA_LACBA|7e-04|29.2|96/100| TM:NTM 1 TM:REGION 3->25| NREPEAT 1 REPEAT 2|77->99|101->123| HM:PFM:NREP 1 HM:PFM:REP 47->150|PF11832|2.5e-05|10.7|103/536|DUF3352| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,150-151| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEcEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //