[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51021.1
DDBJ      :             Lytic transglycosylase, catalytic
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  584/915 : Eukaryota  2/199 : Viruses  6/175   --->[See Alignment]
d.2.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   105->214 1qsaA PDBj 7e-16 43.6 %
:RPS:PDB   91->193 1a4vA PDBj 9e-27 5.8 %
:RPS:SCOP  92->214 1qsaA2  d.2.1.6 * 7e-27 38.2 %
:HMM:SCOP  74->219 153lA_ d.2.1.5 * 3.2e-45 46.6 %
:RPS:PFM   97->190 PF01464 * SLT 1e-20 55.3 %
:HMM:PFM   96->193 PF01464 * SLT 3.2e-32 40.8 98/121  
:BLT:SWISS 93->207 YJBJ_BACSU 7e-38 56.5 %
:PROS 113->141|PS00922|TRANSGLYCOSYLASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51021.1 GT:GENE ABO51021.1 GT:PRODUCT Lytic transglycosylase, catalytic GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2731814..2732467) GB:FROM 2731814 GB:TO 2732467 GB:DIRECTION - GB:PRODUCT Lytic transglycosylase, catalytic GB:NOTE PFAM: Lytic transglycosylase, catalytic KEGG: mta:Moth_1608 lytic transglycosylase, catalytic GB:PROTEIN_ID ABO51021.1 GB:DB_XREF GI:134053050 InterPro:IPR000189 InterPro:IPR008258 LENGTH 217 SQ:AASEQ MDASLVAQLIRLQALEIGINGTQENKSEQSAEFSLMLAKLIAAKAGVRGNTLPLNPGVNLAEVPFLPSKQARASAAAAAASFRAAVGPVREYEAMVEKSALRHGIDPALCKAVARAESDFNPRVTSRTGAMGLMQLMPGTARDLGVKNPYDPEQNADGGVRYLKSMLERFDGDVNKALAAYNAGPGAVERYGGIPPYEETTRYIQKVIRYQQKYTGV GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 93->207|YJBJ_BACSU|7e-38|56.5|115/181| PROS 113->141|PS00922|TRANSGLYCOSYLASE|PDOC00713| SEG 71->85|arasaaaaaasfraa| BL:PDB:NREP 1 BL:PDB:REP 105->214|1qsaA|7e-16|43.6|110/618| RP:PDB:NREP 1 RP:PDB:REP 91->193|1a4vA|9e-27|5.8|103/123| RP:PFM:NREP 1 RP:PFM:REP 97->190|PF01464|1e-20|55.3|94/113|SLT| HM:PFM:NREP 1 HM:PFM:REP 96->193|PF01464|3.2e-32|40.8|98/121|SLT| RP:SCP:NREP 1 RP:SCP:REP 92->214|1qsaA2|7e-27|38.2|123/168|d.2.1.6| HM:SCP:REP 74->219|153lA_|3.2e-45|46.6|146/0|d.2.1.5|1/1|Lysozyme-like| OP:NHOMO 1282 OP:NHOMOORG 592 OP:PATTERN -------------------------------------------------------------------- 13611---------------------------------2111122-------121--1----1-1--1-1------------11-11-1122-2---------121-11-----------------1111-2211----11---12111-1111-1111111111111111-1-----1-----1-11---21111111111111111111111211111111--11111122------------------------------------------------------------------------------------------23123222222222222222----221131122222222-33222221-122-4333112121-2141152511222221222215-22113622745-411311121342261127373333453333333332763422111---------------------------165452111111111111111111231111112223333-122321422223311215122421111111111225463222343141443133333333434437342------------1-------1----21641222422233222233322223233234--31323------32134413333333333-3333333333333333223343333433222222322222222443344432-333333333333---1-----11112422-111122211112222334333222244444432323544322221--------35752221226332233222222222222--743311111111111111--------------------------1----12111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----2---- ----------------------------------------------------------------11--1---------------------------------------------------------1-----------------------------------1-----------1 STR:NPRED 128 STR:RPRED 59.0 SQ:SECSTR ######################################################################################HHHHHHHHHHGGGTTGGGccHHHHHHHHHHHHTTcTTcEEEccccEEETTTTEETTTTcccTTcTTcccTTcccGGGGcHHHHHHHHHHHHHTcGGGcHHHHHHccccccHHHHHHHHHHHHTTccTH### DISOP:02AL 1-3,17-33,75-78| PSIPRED ccccHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccHHHHHcHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc //