[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51029.1
DDBJ      :             nicotinate-nucleotide adenylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  670/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->199 2qtmA PDBj 2e-39 42.8 %
:RPS:PDB   2->199 3dv2B PDBj 4e-35 41.9 %
:RPS:SCOP  4->199 1k4kA  c.26.1.3 * 4e-49 36.4 %
:HMM:SCOP  1->203 1nupA_ c.26.1.3 * 3.2e-60 39.3 %
:RPS:PFM   6->172 PF01467 * CTP_transf_2 3e-15 37.8 %
:HMM:PFM   6->174 PF01467 * CTP_transf_2 1.3e-36 34.6 156/157  
:BLT:SWISS 6->202 NADD_THEPX 5e-64 60.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51029.1 GT:GENE ABO51029.1 GT:PRODUCT nicotinate-nucleotide adenylyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2739197..2739805) GB:FROM 2739197 GB:TO 2739805 GB:DIRECTION - GB:PRODUCT nicotinate-nucleotide adenylyltransferase GB:NOTE KEGG: mta:Moth_0564 nicotinate-nucleotide adenylyltransferase-like TIGRFAM: cytidyltransferase-related domain; nicotinate (nicotinamide) nucleotide adenylyltransferase PFAM: cytidylyltransferase GB:PROTEIN_ID ABO51029.1 GB:DB_XREF GI:134053058 InterPro:IPR004820 InterPro:IPR004821 InterPro:IPR005248 LENGTH 202 SQ:AASEQ MQEICLMGGTFDPIHYGHLVVAEEVRQRFHLDKVVFVPAGKPPHKQDKEISDAQHRIAMTRLATFSNPYFEVSTIEVARQGFSYTVDTVEEIINQYGIKQVYFITGADAVLEILTWKDAPRLLSMTNFIAATRPGYDLSNLKEILNLLHPDILKRILPLEVPALSISSSDIRRRAKEGRSIKYLLPEPVEDYIFKNGLYALD GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 6->202|NADD_THEPX|5e-64|60.4|197/211| BL:PDB:NREP 1 BL:PDB:REP 1->199|2qtmA|2e-39|42.8|187/189| RP:PDB:NREP 1 RP:PDB:REP 2->199|3dv2B|4e-35|41.9|186/188| RP:PFM:NREP 1 RP:PFM:REP 6->172|PF01467|3e-15|37.8|143/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 6->174|PF01467|1.3e-36|34.6|156/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 4->199|1k4kA|4e-49|36.4|195/213|c.26.1.3| HM:SCP:REP 1->203|1nupA_|3.2e-60|39.3|201/0|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 694 OP:NHOMOORG 685 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------1-1111111111111111111-------11-----------1111----------------1111-1111111111111111111111111111112111111111221111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111-1111111--------------------------------------111-------1---11---1--1-----------------------------------------------------1-----1111-11111111111111111111111111111111111-----111-1111111111111111111111111111-1111111111111111111-111111-1--1111-11111-11111-1111111-1111111111111111111111111111--11111--11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--1111111111111111----------------------1111111111111111111111---------1--------------111111111-11111111----1111111111111----1-11111111111111111111111111111111 -1----1----------1------------------------------------------------------------------------------------------------------------1----------1---------------1-1---111--------1--1-1---------1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 99.0 SQ:SECSTR ccEEEEEEEccccccHHHHHHHHHHHHHTTccEEEEEEcccccccccTTcccHHHHHHHHHHHHTTcTTEEEccHHHHccccccHHHHHHHHHHHcTTcEEEEEEETTTTccGGGcTTHHHHHHHcccEEEEcTTccccHHHHHHHHTTcccccccEEEEcccccccHHHHHHHHHTTcccTTcccHHHHHHHHHTTccc## DISOP:02AL 201-203| PSIPRED ccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEccHHHHccccEEHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHccccHHHcccHHHHHHHHHccccccc //