[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51030.1
DDBJ      :             histidine triad (HIT) protein
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  206/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->129 2eo4A PDBj 2e-12 32.1 %
:RPS:SCOP  19->153 1y23A  d.13.1.1 * 2e-24 26.7 %
:HMM:SCOP  1->160 1emsA1 d.13.1.1 * 2.3e-45 38.6 %
:RPS:PFM   36->128 PF01230 * HIT 1e-14 36.3 %
:HMM:PFM   33->125 PF01230 * HIT 7.9e-18 35.2 91/98  
:BLT:SWISS 20->129 Y866_METJA 4e-12 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51030.1 GT:GENE ABO51030.1 GT:PRODUCT histidine triad (HIT) protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2739895..2740404) GB:FROM 2739895 GB:TO 2740404 GB:DIRECTION - GB:PRODUCT histidine triad (HIT) protein GB:NOTE PFAM: histidine triad (HIT) protein KEGG: tko:TK0868 probable bis(5'-adenosyl)-triphosphatase, HIT family GB:PROTEIN_ID ABO51030.1 GB:DB_XREF GI:134053059 InterPro:IPR001310 LENGTH 169 SQ:AASEQ MENLWAPWRSIYIGKPQTGCIFCEKLNSDQDEENLVIYRGDKTFVIMNLYPYNNGHLLIAPKRHVGDITELTDEELLELHKMTQFMVQALRRAFGNPHGFNIGINLGKVAGAGIPGHLHVHIVPRWDGDANFMAVIGDTRVISEGLQRTYEKITRAITALKSEGSTNGN GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 20->129|Y866_METJA|4e-12|32.4|105/129| SEG 69->79|teltdeellel| BL:PDB:NREP 1 BL:PDB:REP 20->129|2eo4A|2e-12|32.1|106/149| RP:PFM:NREP 1 RP:PFM:REP 36->128|PF01230|1e-14|36.3|91/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 33->125|PF01230|7.9e-18|35.2|91/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 19->153|1y23A|2e-24|26.7|131/139|d.13.1.1| HM:SCP:REP 1->160|1emsA1|2.3e-45|38.6|153/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 294 OP:NHOMOORG 259 OP:PATTERN 22111121111111121211211111111111---11--1----111-11111-2222221--11--- 1111111111111111111-121112111111112113221111111111111111111111111111111----111-----11211--------------------1----------------11111111111111--11111---------------------111------------------11-----------------------------1---------------------------------111------1---------1----11-------------------------------------------------2222222-2------------------21-211-1----------11-----------------------------------------------------------------------------------------------------------------------1----------111111-------1-------111-1-------------1-1-----1------------------11--11111211212111-111121111-112111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111111----------------------1-----1--------1--------11- --------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 70.4 SQ:SECSTR ################ccccHHHHHHTEcTcccccEEEEcccEEEEEccccccTTcEEEEEccccccGGGccHHHHHHHHHHHHHHHHHHHHHTTTccEEEEEccccGGGTccccccccEEEEEEcccccccccc################################## DISOP:02AL 162-162,164-170| PSIPRED ccccccHHHHHHHcccccccEEEEEEccccccccEEEEEccEEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHcccccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //