[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51038.1
DDBJ      :             S23 ribosomal protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.16
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->113 2gscD PDBj 2e-13 34.5 %
:RPS:SCOP  3->114 2rldA1  a.29.16.1 * 2e-15 26.6 %
:RPS:PFM   5->110 PF05635 * Ribosomal_S23p 4e-21 47.6 %
:HMM:PFM   3->112 PF05635 * Ribosomal_S23p 8.7e-38 50.5 109/110  
:BLT:SWISS 25->97 RPOC_STRSY 9e-05 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51038.1 GT:GENE ABO51038.1 GT:PRODUCT S23 ribosomal protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2749330..2749683) GB:FROM 2749330 GB:TO 2749683 GB:DIRECTION - GB:PRODUCT S23 ribosomal protein GB:NOTE PFAM: S23 ribosomal protein KEGG: chy:CHY_0463 intervening sequence, 23S rRNA GB:PROTEIN_ID ABO51038.1 GB:DB_XREF GI:134053067 InterPro:IPR008815 LENGTH 117 SQ:AASEQ MIKDYHDLEVYKRGYKLALQIHKTTKGFPQHELYEIGSQIRRAAVSIPLNIAEGYGRKNYVDDFKRFLINALGSCNEVAVLLDMIKDLGYISDQYEGFKEEYDYLGRQLNKLIQTWK GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 25->97|RPOC_STRSY|9e-05|40.0|65/1215| BL:PDB:NREP 1 BL:PDB:REP 3->113|2gscD|2e-13|34.5|110/115| RP:PFM:NREP 1 RP:PFM:REP 5->110|PF05635|4e-21|47.6|105/109|Ribosomal_S23p| HM:PFM:NREP 1 HM:PFM:REP 3->112|PF05635|8.7e-38|50.5|109/110|Ribosomal_S23p| RP:SCP:NREP 1 RP:SCP:REP 3->114|2rldA1|2e-15|26.6|109/113|a.29.16.1| OP:NHOMO 91 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- 11-------------------------------------------------------------------------------------2---1-------1-326--112--------------------11----2------------1------------------134----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------8----1-44-------1---------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--------111-1-31-------------------------------1--------------------------------1-----------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------1--11-11-------------22---------------------------------------3---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 94.0 SQ:SECSTR ##ccGGGcHHHHHHHHHHHHHHHHHTTccGGGTTTHHHHHHHHHHHHHHHHHHHHHccc#HHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-2,117-118| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc //