[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51043.1
DDBJ      :             signal transduction histidine kinase regulating citrate/malate metabolism
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.123.1
:185 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->61 1ixmB PDBj 3e-07 33.9 %
:RPS:SCOP  3->148 1f51A  d.123.1.1 * 4e-09 16.6 %
:HMM:SCOP  1->66 1ixmA_ d.123.1.1 * 3.1e-19 40.9 %
:BLT:SWISS 2->153 CITS_BACHD 4e-09 25.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51043.1 GT:GENE ABO51043.1 GT:PRODUCT signal transduction histidine kinase regulating citrate/malate metabolism GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2757096..2757653) GB:FROM 2757096 GB:TO 2757653 GB:DIRECTION - GB:PRODUCT signal transduction histidine kinase regulating citrate/malate metabolism GB:NOTE KEGG: mta:Moth_1622 signal transduction histidine kinase regulating citrate/malate metabolism GB:PROTEIN_ID ABO51043.1 GB:DB_XREF GI:134053072 LENGTH 185 SQ:AASEQ MDIKNLLEVIQVQRHDFLNHLQVISGLLQLNKGERVRDYINQVCVEYENLSKITRIKSPEVKAVLLVASNEASKCQINFQFDITTNLASLDVPGEAVASALSRCIKHALKFLTPPEVTDRRMRLTISEGEKKITIKLGFPGVPAEVVKDAQEQMSLSEALAAYNSNSKMAVTEKEAEIYMIFPKK GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 2->153|CITS_BACHD|4e-09|25.2|151/538| BL:PDB:NREP 1 BL:PDB:REP 6->61|1ixmB|3e-07|33.9|56/175| RP:SCP:NREP 1 RP:SCP:REP 3->148|1f51A|4e-09|16.6|145/181|d.123.1.1| HM:SCP:REP 1->66|1ixmA_|3.1e-19|40.9|66/179|d.123.1.1|1/1|Sporulation response regulatory protein Spo0B| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11111--1-----11-------------111411-1--4---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 30.3 SQ:SECSTR #####HHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHTTTcHHH############################################################################################################################ PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccEEEEEEccccccHHHHHHHHHHccHHHHHHHHccccccEEcHHEEEEEEEcccc //