[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51056.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->120 PF04093 * MreD 1e-07 40.2 %
:HMM:PFM   4->146 PF04093 * MreD 8e-17 19.7 142/160  
:BLT:SWISS 54->134 MRED_ECOLI 3e-04 25.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51056.1 GT:GENE ABO51056.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2770318..2770818) GB:FROM 2770318 GB:TO 2770818 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: swo:Swol_1639 hypothetical protein GB:PROTEIN_ID ABO51056.1 GB:DB_XREF GI:134053085 LENGTH 166 SQ:AASEQ MRSIVFFLLITISLLLQSTVFTFLQVAGIKPDLVLMFVVFNGFLRGSREGAFLGFLAGLAQDIFTGSYIGLNALTKMLAGYLVGLAETRFYKESVIIVSMVTFVVGVVNQVILYLLLFYLNVEISPYYAFGQVIIPSAIYTGLLVPLSYWEFYSSNEKGWLRQREF GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 54->134|MRED_ECOLI|3e-04|25.9|81/162| TM:NTM 4 TM:REGION 13->35| TM:REGION 57->79| TM:REGION 97->119| TM:REGION 128->149| SEG 3->20|sivffllitislllqstv| RP:PFM:NREP 1 RP:PFM:REP 24->120|PF04093|1e-07|40.2|97/158|MreD| HM:PFM:NREP 1 HM:PFM:REP 4->146|PF04093|8e-17|19.7|142/160|MreD| GO:PFM:NREP 2 GO:PFM GO:0008360|"GO:regulation of cell shape"|PF04093|IPR007227| GO:PFM GO:0016021|"GO:integral to membrane"|PF04093|IPR007227| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11111-1-1-----------1---11-11111111-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 165-167| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccc //