[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51060.1
DDBJ      :             maf protein
Swiss-Prot:Y2550_DESRM  RecName: Full=Maf-like protein Dred_2550;

Homologs  Archaea  12/68 : Bacteria  716/915 : Eukaryota  153/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:191 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->186 1ex2A PDBj 8e-42 47.0 %
:RPS:PDB   1->186 2amhA PDBj 1e-46 24.7 %
:RPS:SCOP  1->186 2amhA1  c.51.4.2 * 9e-60 24.7 %
:HMM:SCOP  1->186 2amhA1 c.51.4.2 * 6.4e-59 48.4 %
:RPS:PFM   4->188 PF02545 * Maf 4e-42 50.8 %
:HMM:PFM   3->188 PF02545 * Maf 8e-64 47.8 186/195  
:BLT:SWISS 1->191 Y2550_DESRM e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51060.1 GT:GENE ABO51060.1 GT:PRODUCT maf protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2773427..2774002) GB:FROM 2773427 GB:TO 2774002 GB:DIRECTION - GB:PRODUCT maf protein GB:NOTE TIGRFAM: maf protein PFAM: Maf family protein KEGG: mta:Moth_0535 maf protein GB:PROTEIN_ID ABO51060.1 GB:DB_XREF GI:134053089 InterPro:IPR003697 LENGTH 191 SQ:AASEQ MRPIILASASPRRQELLKNLGLEFEVQVSDVDENLEENISSGQLVEKLAERKAAAVALIRTQGLVIGADTIVVLGDKPLGKPTNREEAVQMLSNLQGKSHEVFTGLAVIDASTGQRVVTHQVTEVNFKTLTKDQIERYVDTGEPMDKAGGYAVQGLASIFIDSIRGCYFSVVGLPISKLADALRMFGVEIV GT:EXON 1|1-191:0| SW:ID Y2550_DESRM SW:DE RecName: Full=Maf-like protein Dred_2550; SW:GN OrderedLocusNames=Dred_2550; SW:KW Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->191|Y2550_DESRM|e-103|100.0|191/191| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| BL:PDB:NREP 1 BL:PDB:REP 2->186|1ex2A|8e-42|47.0|183/185| RP:PDB:NREP 1 RP:PDB:REP 1->186|2amhA|1e-46|24.7|186/195| RP:PFM:NREP 1 RP:PFM:REP 4->188|PF02545|4e-42|50.8|185/193|Maf| HM:PFM:NREP 1 HM:PFM:REP 3->188|PF02545|8e-64|47.8|186/195|Maf| GO:PFM:NREP 1 GO:PFM GO:0005737|"GO:cytoplasm"|PF02545|IPR003697| RP:SCP:NREP 1 RP:SCP:REP 1->186|2amhA1|9e-60|24.7|186/195|c.51.4.2| HM:SCP:REP 1->186|2amhA1|6.4e-59|48.4|186/0|c.51.4.2|1/1|ITPase-like| OP:NHOMO 1231 OP:NHOMOORG 881 OP:PATTERN ----1--------------------------------------------1111-1111111------- 111-111111111111111-1-11111111111111-111-1---1-111111-11-1--1111-11111-1-11111111111----1111-111---111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11------11--------------------1---11---------111-----------1-------------------------------11---111-11111111111111111111111111111111111111111111111-1-1-1222222222112212222222222222222222-11111111221112222222222111222221111112211111111211-1212111111111111111111111111111111122122222222232222222222222222222222222222222222222222222222222222222122222221111111111111111111112111112211-1--111111------------11-22222222222222222222222222222222--22222------22222222222222222-2222222222222222222222222222222222222222222222122221-222222222222---2-----111122222111---1-------122222221112222222222222222222---------22222222222222222221222221111112-111111---1-1111-1-------------------------1111111111-11 11--111-1-111111111111111111111111111111-111-1-111111111111111111-1111-111111-1111111111--2111-111-1-11111-121-141113------------392-22---1-111---1------31111211111111111-11211121E211112214112-111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 97.9 SQ:SECSTR ccEEEEccccHHHHHHHTTTccEEEEccccccGGGcccccHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEEETTEEEcccccHHHHHHHHHHHTTcEEEEEEEEEEEETTcccEEEEEEEEEEEEccccHHHHHHHHHHcGGGGcGGGccTTcHHHTTEEEEEccHHHHHTccHHHHHHHHHTcc#### PSIPRED ccEEEEccccHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccEEccccccHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEEEEEEEccccHHHHHHHHHHccEEcccEEEEEcccHHHHHHHcccccccEEcccHHHHHHHHHHcccccc //