[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51065.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51065.1 GT:GENE ABO51065.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2780899..2781366) GB:FROM 2780899 GB:TO 2781366 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: cac:CAC2280 predicted membrane protein GB:PROTEIN_ID ABO51065.1 GB:DB_XREF GI:134053094 LENGTH 155 SQ:AASEQ MTSMGKLTFVQWRKHDVKEDKPFKKGAVGTGLVRAFSVTLAVLVMMGFAVAVTHQSVYHFSMLILLTVLASAAMGGGSAGAVAGIRGWQHGGMTGLIYGMFLVVAGALTGVLIFDPVLLTTAITIAGTIGGVIGVNLPSTRKRLVNRRYLNTFNR GT:EXON 1|1-155:0| TM:NTM 4 TM:REGION 29->51| TM:REGION 62->84| TM:REGION 92->114| TM:REGION 119->140| SEG 70->87|asaamgggsagavagirg| SEG 120->135|ttaitiagtiggvigv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,154-156| PSIPRED ccccccEEEEHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc //