[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51068.1
DDBJ      :             small GTP-binding protein
Swiss-Prot:ENGB_DESRM   RecName: Full=Probable GTP-binding protein engB;

Homologs  Archaea  13/68 : Bacteria  741/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->196 1sulB PDBj 1e-55 50.3 %
:RPS:PDB   22->197 3a1uB PDBj 1e-17 25.6 %
:RPS:SCOP  22->197 1nrjB  c.37.1.8 * 2e-14 12.9 %
:HMM:SCOP  14->194 2akaB1 c.37.1.8 * 2.4e-41 29.5 %
:RPS:PFM   26->196 PF02421 * FeoB_N 5e-05 28.8 %
:HMM:PFM   35->144 PF01926 * MMR_HSR1 5.3e-21 24.0 104/108  
:HMM:PFM   107->194 PF00009 * GTP_EFTU 1.1e-10 25.0 88/189  
:BLT:SWISS 1->205 ENGB_DESRM e-117 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51068.1 GT:GENE ABO51068.1 GT:PRODUCT small GTP-binding protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2784194..2784811) GB:FROM 2784194 GB:TO 2784811 GB:DIRECTION - GB:PRODUCT small GTP-binding protein GB:NOTE TIGRFAM: small GTP-binding protein PFAM: GTP-binding protein, HSR1-related; Miro domain protein KEGG: cpf:CPF_1643 GTP-binding protein GB:PROTEIN_ID ABO51068.1 GB:DB_XREF GI:134053097 InterPro:IPR002917 InterPro:IPR005225 InterPro:IPR005289 InterPro:IPR013684 LENGTH 205 SQ:AASEQ MKIVAAEFVTSAVNPGGYPPGNLPEVAFVGRSNVGKSSLINKVVNRKGLAKTSSTPGRTQLINFFNINNDQFLMVDLPGYGYAKVPTDVRIKWGKMIEGYLKERECLKGVVLLIDSRHTPTAQDKQMYEWLQYYHVPTVVVATKVDKLSNNQWAKQQAVIKKSLPLSKEHQLISFSAETGRGKEKLLKVLDEFIHKDGINLTAIE GT:EXON 1|1-205:0| SW:ID ENGB_DESRM SW:DE RecName: Full=Probable GTP-binding protein engB; SW:GN Name=engB; OrderedLocusNames=Dred_2558; SW:KW Cell cycle; Cell division; Complete proteome; GTP-binding;Nucleotide-binding; Septation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|ENGB_DESRM|e-117|100.0|205/205| GO:SWS:NREP 5 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| BL:PDB:NREP 1 BL:PDB:REP 1->196|1sulB|1e-55|50.3|195/195| RP:PDB:NREP 1 RP:PDB:REP 22->197|3a1uB|1e-17|25.6|160/246| RP:PFM:NREP 1 RP:PFM:REP 26->196|PF02421|5e-05|28.8|153/188|FeoB_N| HM:PFM:NREP 2 HM:PFM:REP 35->144|PF01926|5.3e-21|24.0|104/108|MMR_HSR1| HM:PFM:REP 107->194|PF00009|1.1e-10|25.0|88/189|GTP_EFTU| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 1 RP:SCP:REP 22->197|1nrjB|2e-14|12.9|170/191|c.37.1.8| HM:SCP:REP 14->194|2akaB1|2.4e-41|29.5|176/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1007 OP:NHOMOORG 898 OP:PATTERN ------------------------1--11111---11-------------11-1-11----------- 111-------------------------------------------1-------------------------------1111-21112111111111--111111111-1--------------111111111111-------------------------------------------------------11111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111--1111-121--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--1111111111111111111-1111111111111111111111111111111111111111111111111111111112111111111111111111121111111111111112122221111111111111111111111111111111112111111111211111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111--------1-111111-11111111111111111111111111111--- 32--221-734----1-111111111111111111111111111111111-111---11111-11111-11-11111-11111111-----1-111-------221-1632-211121-1111111-31662-312--1-2---1-1-1-111211111----21-----3--1-1223F3321133481324321111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 97.1 SQ:SECSTR cccccEEEEEHHHHHHTHHHHcEEEEEEEccTTccHHHHHHHHHTcccccEEcccEEccEEEEEEEETTEEEEEEEccccccccccHHHHHHHHHHccccHHccccEcEEEEEEETTcccHHHHHHHHHHHTHTTccEEEEEEcHHHHHccHHHTTccccHHHHHHHHcccEEEccTTTcTTHHHHHHHHHHHHTcccc###### DISOP:02AL 1-1,201-206| PSIPRED cEEEEEEEEEEcccHHHcccccccEEEEEccccccHHHHHHHHHccccEEEEccccccEEEEEEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHcccHHccc //