[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51078.1
DDBJ      :             AzlC family protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  421/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->153 PF03591 * AzlC 4e-30 50.7 %
:HMM:PFM   13->154 PF03591 * AzlC 1.2e-51 52.8 142/143  
:HMM:PFM   165->227 PF09964 * DUF2198 3.6e-05 21.0 62/74  
:BLT:SWISS 4->178 Y1331_HELPY 5e-22 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51078.1 GT:GENE ABO51078.1 GT:PRODUCT AzlC family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2796992..2797693 GB:FROM 2796992 GB:TO 2797693 GB:DIRECTION + GB:PRODUCT AzlC family protein GB:NOTE PFAM: AzlC family protein KEGG: mta:Moth_1241 AzlC-like GB:PROTEIN_ID ABO51078.1 GB:DB_XREF GI:134053107 InterPro:IPR011606 LENGTH 233 SQ:AASEQ MTHSFKEGFKAALPVVFGYFPIGMAFGVLAVQSGMTTLEVFMMSLLVYAGSAQFIAASLLATQASIGTIIFTTFLVNSRHLLMTASLAPYMKKISSKLLSLLGFWVTDETFAVSIAAVAKEPKDKGFFLGLYITSHVAWISSTVLGSMMGNFIPNPEKFGLDFALPAMFIALLILQVRHKKALAIIIISAALSIGIKLNMAGSWNIILATVISATIGVLMDKWMEKSSQSLSA GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 4->178|Y1331_HELPY|5e-22|31.2|173/228| TM:NTM 5 TM:REGION 9->31| TM:REGION 47->69| TM:REGION 127->149| TM:REGION 167->189| TM:REGION 202->224| SEG 92->102|kkisskllsll| SEG 180->198|kkalaiiiisaalsigikl| RP:PFM:NREP 1 RP:PFM:REP 14->153|PF03591|4e-30|50.7|140/142|AzlC| HM:PFM:NREP 2 HM:PFM:REP 13->154|PF03591|1.2e-51|52.8|142/143|AzlC| HM:PFM:REP 165->227|PF09964|3.6e-05|21.0|62/74|DUF2198| OP:NHOMO 534 OP:NHOMOORG 435 OP:PATTERN --------------------1--11---1-11------1111---------11--------------- ----11112221111------1----------1----111-------1-------1--------1--1---1----11-111--------------------------------------------------------------2---------------------------------------1111---121111111211111111111111111111111111111111-11111111111111111111-2--1-1---221111-21-1-111111----1111--111-1111-------------111111111--21-1---------11111----1-111111-122-1111-1111---1---------------------1111122212221222---------121--2212221122211---1211111111---------------------------------------------1-----222133333331111133222222233232222-122311---211111--2----22--111-1----1--11-1112111111-1-1--1----1-----1-111-------111111111-1-----11112-1--11-2111-1-111111--111-------------1112-1-1111111111-11111111111111111112122211-----------------11111111--111111111111---------------112111111-1111-1112322221111--11111121113111-------------1---111111211111---------------1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,226-234| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //