[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51082.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->69 1smtB PDBj 6e-04 46.7 %
:RPS:PDB   8->65 2dk5A PDBj 3e-04 22.2 %
:RPS:SCOP  8->65 2dk5A1  a.4.5.85 * 4e-04 20.4 %
:RPS:PFM   3->62 PF04963 * Sigma54_CBD 1e-04 33.3 %
:HMM:PFM   39->76 PF01978 * TrmB 5.7e-05 35.3 34/68  
:HMM:PFM   71->96 PF08701 * GN3L_Grn1 0.0008 34.6 26/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51082.1 GT:GENE ABO51082.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2802675..2802983 GB:FROM 2802675 GB:TO 2802983 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51082.1 GB:DB_XREF GI:134053111 LENGTH 102 SQ:AASEQ MPHLLKVRSLAQLNEIERNVLFFVRENTSPDGMLIYPLRDIGKTLGYSELEVQRTLRNLENLKLVDYREGESPGDPNMILYKDEWLNEFTQKHSSQMSDFNS GT:EXON 1|1-102:0| BL:PDB:NREP 1 BL:PDB:REP 40->69|1smtB|6e-04|46.7|30/101| RP:PDB:NREP 1 RP:PDB:REP 8->65|2dk5A|3e-04|22.2|54/91| RP:PFM:NREP 1 RP:PFM:REP 3->62|PF04963|1e-04|33.3|60/195|Sigma54_CBD| HM:PFM:NREP 2 HM:PFM:REP 39->76|PF01978|5.7e-05|35.3|34/68|TrmB| HM:PFM:REP 71->96|PF08701|0.0008|34.6|26/80|GN3L_Grn1| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF04963|IPR007046| GO:PFM GO:0006352|"GO:transcription initiation"|PF04963|IPR007046| RP:SCP:NREP 1 RP:SCP:REP 8->65|2dk5A1|4e-04|20.4|54/78|a.4.5.85| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 56.9 SQ:SECSTR #######cccccccccHHHHHHHHHHH#cTTcE###EHHHHHHHTTccHHHHHHHHHHHHHTTcEEEEE################################# DISOP:02AL 1-2,94-103| PSIPRED cccHHHHHHHHHHHHHHHEEEEEEEcccccccEEEEEHHHHHHHcccHHHHHHHHHHcHHccEEEEEccccccccccEEEEEHHHHHHHHHHHHHHHHHccc //