[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51095.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51095.1 GT:GENE ABO51095.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2813450..2813839) GB:FROM 2813450 GB:TO 2813839 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: gka:GK3286 hypothetical protein GB:PROTEIN_ID ABO51095.1 GB:DB_XREF GI:134053124 LENGTH 129 SQ:AASEQ MIFSADDPFERSIILKNGTWEYKILPNHPEVKPYLIQLKNLIENPYYIVKDMVQMDKEQKAVHPTREEYIDVIPNKSTGFVMIKAIVDHNTNPSEIVTALISSKVRGLTSEGGFVYVRSEETDDKKKTE GT:EXON 1|1-129:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-59,121-130| PSIPRED cEEEEccccccEEEEEcccEEEEEccccccHHHHHHHHHHHHcccEEEEccHHcccccHHcccHHHHHHHHHcccccccEEEEEEEEEccccHHHHHHHHHHHHHHcccccccEEEEcccccccHHccc //