[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51101.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->87 PF07439 * DUF1515 2.9e-05 32.9 73/112  
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51101.1 GT:GENE ABO51101.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2815721..2816035) GB:FROM 2815721 GB:TO 2816035 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51101.1 GB:DB_XREF GI:134053130 LENGTH 104 SQ:AASEQ MGESDVQSIREDLREVKKALSELTAAMADLRVQVAGNYVTKVDFLKCQECAEKRIVKLHDRIEQHELQDKADRWKLAGLVATVTGIVLSVIQWIASLYRSGGQS GT:EXON 1|1-104:0| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 2->36| TM:NTM 1 TM:REGION 76->98| HM:PFM:NREP 1 HM:PFM:REP 5->87|PF07439|2.9e-05|32.9|73/112|DUF1515| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,102-105| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //