[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51109.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   66->96 PF07955 * DUF1687 0.00051 35.5 31/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51109.1 GT:GENE ABO51109.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2825717..2826130) GB:FROM 2825717 GB:TO 2826130 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: bca:BCE_0407 hypothetical protein GB:PROTEIN_ID ABO51109.1 GB:DB_XREF GI:134053138 LENGTH 137 SQ:AASEQ MFESDRKITIRNKTYPLLFNVIALKEVCERYGGVEKLGEKLQEDYKKAISEYAWVISLLIRQGLALKNFEEDTNEKAPTPEQLEIIMTPKELFSQQPTIIGAINDGMDSGEQEETEEVDEVLEEVLASKNGKGAEGK GT:EXON 1|1-137:0| TM:NTM 1 TM:REGION 48->70| SEG 111->125|eqeeteevdevleev| HM:PFM:NREP 1 HM:PFM:REP 66->96|PF07955|0.00051|35.5|31/133|DUF1687| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,107-116,128-138| PSIPRED cccccccEEEccEEEEEEHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccc //