[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51118.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->93 PF05119 * Terminase_4 1.3e-10 25.9 81/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51118.1 GT:GENE ABO51118.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2833127..2833441) GB:FROM 2833127 GB:TO 2833441 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51118.1 GB:DB_XREF GI:134053147 LENGTH 104 SQ:AASEQ MARKTEIKKDLKNQLERNGVYGSHYLDLINDYMSLWEIKNRLIKDIKTRGVSVEWNNGGGQKGFKKNDSIAELNKTNAQMLKILNELGLKANSSGSGDDDDEEM GT:EXON 1|1-104:0| SEG 56->67|nngggqkgfkkn| SEG 93->101|ssgsgdddd| HM:PFM:NREP 1 HM:PFM:REP 9->93|PF05119|1.3e-10|25.9|81/100|Terminase_4| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------1------111---------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,91-105| PSIPRED ccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //