[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51127.1
DDBJ      :             single-strand binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  665/915 : Eukaryota  9/199 : Viruses  18/175   --->[See Alignment]
b.40.4
:224 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->96 1ue1A PDBj 9e-16 43.0 %
:RPS:PDB   1->105 3eivB PDBj 5e-25 30.1 %
:RPS:SCOP  1->105 1ue1A  b.40.4.3 * 3e-26 35.6 %
:HMM:SCOP  1->170 1se8A_ b.40.4.3 * 1.8e-44 34.4 %
:RPS:PFM   1->99 PF00436 * SSB 1e-15 40.8 %
:HMM:PFM   1->99 PF00436 * SSB 1.3e-35 46.9 98/104  
:HMM:PFM   98->213 PF09770 * PAT1 0.00068 36.6 112/805  
:BLT:SWISS 1->102 SSB_BACHD 7e-21 46.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51127.1 GT:GENE ABO51127.1 GT:PRODUCT single-strand binding protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2842523..2843197) GB:FROM 2842523 GB:TO 2843197 GB:DIRECTION - GB:PRODUCT single-strand binding protein GB:NOTE TIGRFAM: single-strand binding protein PFAM: single-strand binding protein/Primosomal replication protein n; nucleic acid binding, OB-fold, tRNA/helicase-type KEGG: pha:PSHAa2705 single-strand binding protein (ssb) (helix-destabilizing protein) GB:PROTEIN_ID ABO51127.1 GB:DB_XREF GI:134053156 InterPro:IPR000424 InterPro:IPR004365 InterPro:IPR010913 InterPro:IPR011344 LENGTH 224 SQ:AASEQ MNSVNIIGRLTRDPELRYTQNGKAVTNMSIAVQRYGNKDEADFFDCTAFEKTAETIANNLTKGREVGVSGRLQQERWDDQQTGQKRSAVKIMVNSITFIGPKQDNQQQSPNQPPAQQQQYQGPPQGYQQQGFQQPPGYIPPSQGGYPLPQGYPGQMPPQGPPPGQYSQQPGQYQQQPPGYQQTPAGPPNGQPPQGQIDFQFQGQGQGQQPPANGFQGNIDDIPF GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 1->102|SSB_BACHD|7e-21|46.5|101/168| SEG 106->217|qqqspnqppaqqqqyqgppqgyqqqgfqqppgyippsqggyplpqgypgqmppqgpppgqysqqpgqyqqqppgyqqtpagppngqppqgqidfqfqgqgqgqqppangfqg| BL:PDB:NREP 1 BL:PDB:REP 3->96|1ue1A|9e-16|43.0|93/113| RP:PDB:NREP 1 RP:PDB:REP 1->105|3eivB|5e-25|30.1|103/111| RP:PFM:NREP 1 RP:PFM:REP 1->99|PF00436|1e-15|40.8|98/104|SSB| HM:PFM:NREP 2 HM:PFM:REP 1->99|PF00436|1.3e-35|46.9|98/104|SSB| HM:PFM:REP 98->213|PF09770|0.00068|36.6|112/805|PAT1| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 1->105|1ue1A|3e-26|35.6|104/113|b.40.4.3| HM:SCP:REP 1->170|1se8A_|1.8e-44|34.4|160/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 922 OP:NHOMOORG 692 OP:PATTERN -------------------------------------------------------------------- 11-231211121211-111-11111111111111111111111211111111221111--1111111111--111---2221111111-------------11----12----------------11221111222333221113-212111111111111111112221111111111111112-1111-2122222222222222221122122122233111422332115322222212443222212261112212111211133111111322311212121122222323222132212221112211111111111213212122433312222-232212241121121131111111112111-11------------------------------------------------------------------------------------1---------------------------------------111122111111111111--11111112-112211221121--1--1--12111111111111111111-112-1-1111211111111212113111111111111111111111111111111111331111-11111111111111111111111111-2-11111111111111111221121211-211221111122122122111111122111121112122221121111111111111111111111--11111111111-1-----11112111-1-----------1------1111---11-111111111111111111111111111----------1---1-1122111111161111111-1121---1--------11------111-111111111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1---1---11----- -----------------------------1-----------1------------------1-----------------1---11----------1----------1-111------------1----11-----111----------------1--------------------- STR:NPRED 105 STR:RPRED 46.9 SQ:SECSTR ccEEEEEEEEccccEEEEcTTccEEEEEEEEEcccccccccEEEEEEEEHHHHHHHHHHccTTcEEEEEEEEEEEEEEcTTEccEEEEEEEEEEEEEEccccccc####################################################################################################################### DISOP:02AL 107-117,122-221| PSIPRED ccEEEEEEEEccccEEEEcccccEEEEEEEEEccccccccccEEEEEEEccHHHHHHHHHccccEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //