[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51131.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->112 1lq1D PDBj 4e-11 40.7 %
:HMM:SCOP  50->113 1fc3A_ a.4.6.3 * 2.5e-15 39.1 %
:RPS:PFM   59->112 PF08769 * Spo0A_C 1e-11 46.3 %
:HMM:PFM   58->113 PF08769 * Spo0A_C 1.7e-17 42.9 56/106  
:BLT:SWISS 39->112 SP0A_BACSH 2e-13 40.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51131.1 GT:GENE ABO51131.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2845561..2845935) GB:FROM 2845561 GB:TO 2845935 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: mta:Moth_1505 response regulator receiver domain protein (CheY-like) GB:PROTEIN_ID ABO51131.1 GB:DB_XREF GI:134053160 LENGTH 124 SQ:AASEQ MMQSATQQCNPIEALEQAKTMAEQFLAVYPVLAPALDGQAPISEPTTVERPVASIDDQITQLLWDIGIPSHVQGYHYARSAIKLIIENRTMKFEATKKLYPAVATEFNTTPSSRKINKACHSDS GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 39->112|SP0A_BACSH|2e-13|40.5|74/263| BL:PDB:NREP 1 BL:PDB:REP 54->112|1lq1D|4e-11|40.7|59/107| RP:PFM:NREP 1 RP:PFM:REP 59->112|PF08769|1e-11|46.3|54/106|Spo0A_C| HM:PFM:NREP 1 HM:PFM:REP 58->113|PF08769|1.7e-17|42.9|56/106|Spo0A_C| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08769|IPR014879| GO:PFM GO:0005509|"GO:calcium ion binding"|PF08769|IPR014879| GO:PFM GO:0005737|"GO:cytoplasm"|PF08769|IPR014879| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08769|IPR014879| GO:PFM GO:0042173|"GO:regulation of sporulation resulting in formation of a cellular spore"|PF08769|IPR014879| HM:SCP:REP 50->113|1fc3A_|2.5e-15|39.1|64/0|a.4.6.3|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 74 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111--111---1----------1------------------------------------------------------------------------------------------11111111111111111111111112---11112212111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 62.1 SQ:SECSTR ###################################HHcTTccccEEEccEEEEcHHHHHHHHHHHHTccTTcHHHHHHHHHHHHHHHcGGGGGcTTTTHHHHHHHHTTccHH############ DISOP:02AL 1-8,30-55,120-125| PSIPRED cccHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccc //