[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51132.1
DDBJ      :             BRO domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
b.108.1
:205 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  9->101 1v0eA2  b.108.1.3 * 1e-12 9.2 %
:RPS:PFM   12->92 PF02498 * Bro-N 8e-11 42.5 %
:HMM:PFM   12->95 PF02498 * Bro-N 6.6e-23 38.6 83/89  
:BLT:SWISS 13->93 Y1418_HAEIN 7e-08 30.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51132.1 GT:GENE ABO51132.1 GT:PRODUCT BRO domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2846077..2846694) GB:FROM 2846077 GB:TO 2846694 GB:DIRECTION - GB:PRODUCT BRO domain protein GB:NOTE PFAM: BRO domain protein domain protein KEGG: sak:SAK_2090 prophage Sa05, BRO domain protein GB:PROTEIN_ID ABO51132.1 GB:DB_XREF GI:134053161 InterPro:IPR003497 LENGTH 205 SQ:AASEQ MNVKTEIWNGHKIRFVEKEPGDWWAVAADIAKALEYRRIDSMLRKLKPSQKDTHLMSTLGGQQEVSIISETGIYKVITRSRKKEAEQFEDWIFTVIKTLRQASGLEGFQIFRMLDKEHQREAMSRLKAGLVKPVRVDFIKANTIANKAVSSIHGYPKMLKKGDMSPDMLIQRQQILDDTVNLMNVNQNFGLGLSVSKAVYSKYRY GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 13->93|Y1418_HAEIN|7e-08|30.9|81/100| RP:PFM:NREP 1 RP:PFM:REP 12->92|PF02498|8e-11|42.5|80/92|Bro-N| HM:PFM:NREP 1 HM:PFM:REP 12->95|PF02498|6.6e-23|38.6|83/89|Bro-N| RP:SCP:NREP 1 RP:SCP:REP 9->101|1v0eA2|1e-12|9.2|87/150|b.108.1.3| OP:NHOMO 51 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- -------1--1----1------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1----------------------------1---1---------------------------1-------------------1---1---1-------------------------------------------------11------1----------------------------------------------------------------------------------22222222-----------------------------------------------------------------------------------------------------12----1-----3--------1-----------1-------1----------------------------1-----------------------------------------------------------------------------------------------------------1--------------------------------1---------------------11-2----------------------------------------------------------1-1----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1- DISOP:02AL 205-206| PSIPRED cccEEEEEccEEEEEEEEcccEEEEEHHHHHHHHccccHHHHHHHHcHHHccEEEccccccccEEEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHEEHHHHHcccccHHHHHHHHHcc //