[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51136.1
DDBJ      :             protein of unknown function SprT
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->182 PF10263 * SprT-like 3e-08 39.6 %
:HMM:PFM   28->186 PF10263 * SprT-like 8.3e-22 24.1 145/159  
:BLT:SWISS 32->160 SPRT_VIBVY 5e-05 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51136.1 GT:GENE ABO51136.1 GT:PRODUCT protein of unknown function SprT GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2849701..2850270) GB:FROM 2849701 GB:TO 2850270 GB:DIRECTION - GB:PRODUCT protein of unknown function SprT GB:NOTE SMART: protein of unknown function SprT GB:PROTEIN_ID ABO51136.1 GB:DB_XREF GI:134053165 InterPro:IPR006640 LENGTH 189 SQ:AASEQ MADVQLQAKEALKTLLTSDDKVIAMLYEKHQDFNQEYFEGELSFPLISFEKMNTKTLATYTAGKNRLRLENHIRFNIELINLNEDQEEAICEVLKHEMIHQWQDECLYTGEKKPKNWHNKDFKAKAEELGVLVQGTNCPIKMPEGNVKNHSYRYVCGCRDEQNKTLVIRTPFPLEAKCKRCGEEFKIFE GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 32->160|SPRT_VIBVY|5e-05|32.7|113/168| RP:PFM:NREP 1 RP:PFM:REP 33->182|PF10263|3e-08|39.6|134/155|SprT-like| HM:PFM:NREP 1 HM:PFM:REP 28->186|PF10263|8.3e-22|24.1|145/159|SprT-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHEEEHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccHHcccEEEEEcccccEEEEEEEcccccccHHHHHHccccccccc //