[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51145.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->120 PF05228 * CHASE4 2e-09 27.6 %
:HMM:PFM   7->119 PF05228 * CHASE4 7.5e-18 26.5 113/161  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51145.1 GT:GENE ABO51145.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2859096..2859500) GB:FROM 2859096 GB:TO 2859500 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51145.1 GB:DB_XREF GI:134053174 LENGTH 134 SQ:AASEQ MLRSLKKHDINWLENNLLDEDCDFIIVSDKEGSVIANKDAPFDLITEIPVDITNKIKTLDFINGIFLTDKGPAIITVANVKNNEGGGEPPGLLIYGRYITKELLSEVKKTSDSDITIFTNGAIVSTLEQKSEIN GT:EXON 1|1-134:0| RP:PFM:NREP 1 RP:PFM:REP 5->120|PF05228|2e-09|27.6|116/160|CHASE4| HM:PFM:NREP 1 HM:PFM:REP 7->119|PF05228|7.5e-18|26.5|113/161|CHASE4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-5,132-135| PSIPRED ccccccEEEEcccccccccccEEEEEEEccccEEEEEccccHHHHHHcccccccccccccEEEEEEEcccccEEEEEEEccccccccccccEEEEEEEccHHHHHHHHHHHcccEEEEEccccHHHHHHHHccc //