[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51149.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.8
:450 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   39->288 2bwrA PDBj 3e-04 11.7 %
:RPS:SCOP  74->186 1jv2A4  b.69.8.1 * 1e-06 21.5 %
:HMM:SCOP  50->191 1txvA_ b.69.8.1 * 8.2e-06 29.0 %
:HMM:PFM   168->186 PF01839 * FG-GAP 9.4e-05 52.6 19/33  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51149.1 GT:GENE ABO51149.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2862049..2863401) GB:FROM 2862049 GB:TO 2863401 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: btk:BT9727_1805 hypothetical protein GB:PROTEIN_ID ABO51149.1 GB:DB_XREF GI:134053178 InterPro:IPR000437 LENGTH 450 SQ:AASEQ MIRKIKSGITALLISSLLTGCNFMQSPMELLKQPSMDVSQAEMKRAAEQFLPTGSQFTIPLKPSGTGSFRQADLDGDGSKELLAFYKNLQAGYEMGALILKKEDGKWQLQDHIKGLGQSIDYGDLQDVTGDKKPELLVGWSGADGYEKELEIYSFQDKKAKRIGQYTYNSFSTGDLDEDGKAELAVLFRNNKEIPSAELHLYQAVSGELKQTAKLEYEGGYPAGVVIGQASKDRKGIFVDIGEGAHSAVTQLVFLENNTLRNVFSQSRTFKPYSLPSEDVDKDGVMEIGIMYEPPGTEQMAMAEIPWVNRWYKWDGKDGLLPVLEEYSNYIFGYRFIIPQNWIGKFTVKEIEDNPEKGVEFDYIGKGKMPLAKLLTLHIVPQNKWQEQEKEFKKSQAPYIVLGEKGQMVFVGVFPEKENKLSGKPLQEYQELLLKQEQVKEQFEFISSPY GT:EXON 1|1-450:0| SEG 426->445|lqeyqelllkqeqvkeqfef| RP:PDB:NREP 1 RP:PDB:REP 39->288|2bwrA|3e-04|11.7|240/401| HM:PFM:NREP 1 HM:PFM:REP 168->186|PF01839|9.4e-05|52.6|19/33|FG-GAP| RP:SCP:NREP 1 RP:SCP:REP 74->186|1jv2A4|1e-06|21.5|107/438|b.69.8.1| HM:SCP:REP 50->191|1txvA_|8.2e-06|29.0|138/0|b.69.8.1|1/1|Integrin alpha N-terminal domain| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-1-11--------11------1-------1-----------------------------------------------------------------------------------------------1-----------1--------1---------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 53.3 SQ:SECSTR ######################################cTTcccccEEEEccccGGGTccTTTcEEEE###EccccccccEEEEEccccEEEEccccccccccEEEEccccTTcccccTTTccEEEccccccccEEEEEccccEEEEcccccccccccEEccccGGGTccTEEEcccTTcccEEEEEccccEEEcccccccccccEEEEccccGGGTccTTTccEEEEcccccc###ccEEEEEccccEE##EEEEccc##ccEEEEEEEEccccGGGTccGGGcEEE################################################################################################################################################################## DISOP:02AL 1-6,386-393| PSIPRED ccHHHHHcHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEEccccccEEEEEEEccccccEEEEEEEEEEccEEEEEEEEEccccccEEEEEEEEccccccEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEcEEEHHHHcccccEEEEEEEEccccEEEEEEEEHHHHccccccEEEEccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEEEccccccccccccccccEEEccccccccccEEEEEEEEccccccccccccHHHHHHEEcccccccccHHHHHHHEEccEEEEEcHHHcccEEEEEcccccccccccHHcccccccHHHEEEEEEEcccHHHHHHHHHHHHcccEEEEcccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccc //