[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51154.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->34 PF01765 * RRF 0.00027 36.4 33/165  
:BLT:SWISS 6->60 MTP_MOUSE 8e-04 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51154.1 GT:GENE ABO51154.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2867885..2868067) GB:FROM 2867885 GB:TO 2868067 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51154.1 GB:DB_XREF GI:134053183 LENGTH 60 SQ:AASEQ MLSPQMDPKELKLLIPLLAKEDMEDLLKEIDDLIHYEQDAHKLMRLFDNKEILEKAINHY GT:EXON 1|1-60:0| BL:SWS:NREP 1 BL:SWS:REP 6->60|MTP_MOUSE|8e-04|35.3|51/100| HM:PFM:NREP 1 HM:PFM:REP 2->34|PF01765|0.00027|36.4|33/165|RRF| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,59-61| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcc //