[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51162.1
DDBJ      :             dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->152 3fz5C PDBj 5e-04 29.2 %
:RPS:PDB   59->169 1bedA PDBj 6e-11 10.8 %
:RPS:SCOP  3->168 1r4wA  c.47.1.13 * 4e-16 12.1 %
:HMM:SCOP  3->171 1r4wA_ c.47.1.13 * 6.7e-23 24.7 %
:RPS:PFM   30->168 PF01323 * DSBA 2e-11 32.8 %
:HMM:PFM   8->168 PF01323 * DSBA 6.4e-18 20.1 159/193  
:BLT:SWISS 7->168 YWBO_BACSU 9e-08 26.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51162.1 GT:GENE ABO51162.1 GT:PRODUCT dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2876684..2877202 GB:FROM 2876684 GB:TO 2877202 GB:DIRECTION + GB:PRODUCT dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein GB:NOTE KEGG: sth:STH161 hypothetical protein GB:PROTEIN_ID ABO51162.1 GB:DB_XREF GI:134053191 LENGTH 172 SQ:AASEQ MSREYPLDITWVGYELRPERAAEGEKLSNILPGADLKQVFAHYNQAALEYGISINQVDFLPNTHMALMATEFAKDLDMFEEFHSLVFKSFFTEGRDIGNSKVVVDLLVSLNVPREKAAAILNDPVYSDRVKKNRNDAVNFVAGLPTFIIENKKKIVGAQPLNVFRNILDSYH GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 7->168|YWBO_BACSU|9e-08|26.3|156/200| BL:PDB:NREP 1 BL:PDB:REP 64->152|3fz5C|5e-04|29.2|89/187| RP:PDB:NREP 1 RP:PDB:REP 59->169|1bedA|6e-11|10.8|111/181| RP:PFM:NREP 1 RP:PFM:REP 30->168|PF01323|2e-11|32.8|134/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 8->168|PF01323|6.4e-18|20.1|159/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 3->168|1r4wA|4e-16|12.1|165/221|c.47.1.13| HM:SCP:REP 3->171|1r4wA_|6.7e-23|24.7|166/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------1--------------------------------------------------1--1-------------------------------------1-----------------------------------------------1-------------------------1-1---1-------1---------------------------------------------------------------------------------------------1------------------------1-------1-------------------------1-----------------------------1---------1--1---1-------------111------------------------------------------------------------------------------------------------------------------------------------1-----------------2-----------------------------------------------1--------------------------------------------------------------------------------------1--------------------------------------1------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 77.3 SQ:SECSTR ####################################HHHHHHHHHHHHHccTTEEEEEcGGGHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHcccccEEEETTTEcGGGcccHHHHHHHHH### DISOP:02AL 1-2| PSIPRED ccccccEEEEEEEEEcccccccccHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHcccccccEEEEccEEEEcccccHHHHHHHHHHHc //