[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51167.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->117 3f7bB PDBj 6e-04 24.3 %
:HMM:PFM   114->151 PF11594 * Med28 0.00072 23.7 38/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51167.1 GT:GENE ABO51167.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2881096..2881563) GB:FROM 2881096 GB:TO 2881563 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51167.1 GB:DB_XREF GI:134053196 LENGTH 155 SQ:AASEQ MFCQLDQVKQILDMASAVKNILKEERFLNIDLDRKSCSILYGLLLLKDYDVFIQRGTVSFEGREFPHHWTEIYLDGEAFILDINLVSSAKVENRSEDIYFMPEEDAVKDYGYQALQEYGWKKEDCQREIWQRVLKELNISKNVDQVLEEIEEYSL GT:EXON 1|1-155:0| BL:PDB:NREP 1 BL:PDB:REP 3->117|3f7bB|6e-04|24.3|115/247| HM:PFM:NREP 1 HM:PFM:REP 114->151|PF11594|0.00072|23.7|38/128|Med28| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 74.2 SQ:SECSTR ##TTcccccccEEcGGGcEEcTTcccEEEEccccccccEEccEEEEcTTccEEEETTccEEEEEEEEEEcccEETTccccEEEEEEEEEccTTcEEEEEEEEEEEccccGGGHHHHH###################################### DISOP:02AL 4-5,155-156| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHEEEEEEEEEEcccccccccEEEEEcccEEEEEEEEEcccccccccccEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccc //