[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51176.1
DDBJ      :             thioredoxin reductase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  896/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.47.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->287 2q7vB PDBj 3e-55 43.1 %
:BLT:PDB   306->407 1w4vF PDBj 6e-07 25.5 %
:RPS:PDB   26->310 2a87A PDBj 4e-48 37.8 %
:RPS:PDB   310->410 2dmlA PDBj 6e-12 10.9 %
:RPS:SCOP  52->113 1ng3A1  c.3.1.2 * 9e-06 24.6 %
:RPS:SCOP  91->284 1mo9A1  c.3.1.5 * 2e-26 14.4 %
:RPS:SCOP  310->407 1a8lA2  c.47.1.2 * 2e-09 18.4 %
:HMM:SCOP  1->308 1f8rA1 c.3.1.2 * 5.1e-55 31.9 %
:HMM:SCOP  310->410 1ep7A_ c.47.1.1 * 5.6e-16 30.3 %
:RPS:PFM   26->282 PF07992 * Pyr_redox_2 1e-24 38.3 %
:RPS:PFM   310->387 PF00085 * Thioredoxin 8e-06 28.2 %
:HMM:PFM   7->281 PF07992 * Pyr_redox_2 2e-44 36.6 194/202  
:HMM:PFM   308->405 PF00085 * Thioredoxin 4.4e-11 25.5 98/104  
:BLT:SWISS 28->307 TRXB_EUBAC 2e-65 45.1 %
:BLT:SWISS 310->387 THIO2_CORNE 2e-07 39.2 %
:PROS 135->155|PS00573|PYRIDINE_REDOX_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51176.1 GT:GENE ABO51176.1 GT:PRODUCT thioredoxin reductase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2889671..2890903) GB:FROM 2889671 GB:TO 2890903 GB:DIRECTION - GB:PRODUCT thioredoxin reductase GB:NOTE TIGRFAM: thioredoxin reductase PFAM: FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glucose-inhibited division protein A; Thioredoxin domain KEGG: dsy:DSY4471 hypothetical protein GB:PROTEIN_ID ABO51176.1 GB:DB_XREF GI:134053205 InterPro:IPR000103 InterPro:IPR000759 InterPro:IPR001100 InterPro:IPR001327 InterPro:IPR002218 InterPro:IPR005982 InterPro:IPR008255 InterPro:IPR013027 InterPro:IPR013766 LENGTH 410 SQ:AASEQ MSNTTHDIIIIGAGPAGLAAGIYGARAKLRTLIIEKGAIGGMASNTREIVNYPGFKQTSGTALTKEMAEHAKEMGTEIIKGEVKTVDLSGEIKRVVTRKKQEFTARAVILATGTLPRVLGIPGEKELRGNGVAYCATCDAEFFEGQHVVVVGSGDQAIEEGMFIAKFANQVTVIVLHDEGKLDCNRLSAEKALHHPKLKFVWNSTLTAVQGDEEVTGVQVKNIKTGEMSEIPCQGVFFFVGMIPATHFLKGQVELDDRGYVMVNDLLETSVEGVFAAGDLRPKYLRQVVTATADGAAAVVAAERYLQEKENLRTTVLEAEKPVILAFWSPEDQASLQAVSRVEKVVSELPNEYLFVKTDVTRQRMLAKKYQVTTLPRVFVLNKGEVVQTIDTDAEVDDIKEILKALIQQA GT:EXON 1|1-410:0| BL:SWS:NREP 2 BL:SWS:REP 28->307|TRXB_EUBAC|2e-65|45.1|277/315| BL:SWS:REP 310->387|THIO2_CORNE|2e-07|39.2|74/108| PROS 135->155|PS00573|PYRIDINE_REDOX_2|PDOC00496| SEG 8->25|iiiigagpaglaagiyga| SEG 288->302|vvtatadgaaavvaa| BL:PDB:NREP 2 BL:PDB:REP 26->287|2q7vB|3e-55|43.1|260/309| BL:PDB:REP 306->407|1w4vF|6e-07|25.5|102/108| RP:PDB:NREP 2 RP:PDB:REP 26->310|2a87A|4e-48|37.8|283/313| RP:PDB:REP 310->410|2dmlA|6e-12|10.9|101/130| RP:PFM:NREP 2 RP:PFM:REP 26->282|PF07992|1e-24|38.3|248/275|Pyr_redox_2| RP:PFM:REP 310->387|PF00085|8e-06|28.2|78/103|Thioredoxin| HM:PFM:NREP 2 HM:PFM:REP 7->281|PF07992|2e-44|36.6|194/202|Pyr_redox_2| HM:PFM:REP 308->405|PF00085|4.4e-11|25.5|98/104|Thioredoxin| GO:PFM:NREP 1 GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00085|IPR013766| RP:SCP:NREP 3 RP:SCP:REP 52->113|1ng3A1|9e-06|24.6|61/276|c.3.1.2| RP:SCP:REP 91->284|1mo9A1|2e-26|14.4|194/261|c.3.1.5| RP:SCP:REP 310->407|1a8lA2|2e-09|18.4|98/107|c.47.1.2| HM:SCP:REP 1->308|1f8rA1|5.1e-55|31.9|298/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 310->410|1ep7A_|5.6e-16|30.3|99/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 1903 OP:NHOMOORG 1098 OP:PATTERN 11121124333333331122111215311322111111111111111211111111111112111111 2331311111131211112-12111211111122222453242231121111432122--1112122231112222222213113---222212221-1222121413111111111111111111112221122211123111213-111111111122211--1212212122222122221212221133344444444444445424442344333312332222225522222222222222233222232122132112222222134313433333233233111111111111222222222222211222111312235333333333323222332223314123244232213312221221112422311111223332223323311111111111123233111231121111131111213111221111111111111111122211131112222211111111111111111111113312122211244242211112278222212335224323222232322221322221222111111111111132211113352344431121111121114112141111111111111111111111111112222222122122222222222222222221-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121121111111111-11114334423222223333232232222422211111111111112111112222233334332232222111122221111111111113----1-11111111111111111111111321212111 ----111----122312111111111111111112211111111111111121211211111111111-1221112212211111121-11121111111111221112---------1----1---2------1------1111-----------1-1----11--1--1----1351-1113243431321111--3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 410 STR:RPRED 100.0 SQ:SECSTR ccTTcEEEEEEcccHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEEETTccEEEEEEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccccTTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTcTTcccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHHHHcccTTccEEEcccEEEEEccHHHHHHHHcGGGEEEEHHTTTTcEEEEEETTTcHHHHHHHTcccccEEEEEccTTccEEccccccHHHHHHHHHHHHHHc DISOP:02AL 1-1,410-411| PSIPRED cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEcccEEEEEEEEEEEcccEEcccccccHHHcccccEEEEcccccHHccccEEEEEcccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEccEEEEEEEEEcccHHHcccEEEcccccEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccEEEEEccHHHHHHHccHHHHHHHHHccccEEEEEEEEcHHHHHHHHccccEEEEEEEccccEEHHHHcccccHHHHHHHHHHHHccc //