[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51189.1
DDBJ      :             non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
Swiss-Prot:NTPA_DESRM   RecName: Full=Nucleoside-triphosphatase;         EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase;         Short=NTPase;

Homologs  Archaea  61/68 : Bacteria  838/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:201 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->192 2pyuA PDBj 5e-40 47.9 %
:RPS:PDB   1->195 2dvoA PDBj 2e-39 36.1 %
:RPS:SCOP  2->192 1k7kA  c.51.4.1 * 6e-60 47.4 %
:HMM:SCOP  1->195 1k7kA_ c.51.4.1 * 1.7e-70 57.2 %
:RPS:PFM   3->192 PF01725 * Ham1p_like 1e-51 55.9 %
:HMM:PFM   3->191 PF01725 * Ham1p_like 1.7e-76 58.3 187/189  
:BLT:SWISS 1->201 NTPA_DESRM e-107 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51189.1 GT:GENE ABO51189.1 GT:PRODUCT non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2908175..2908780) GB:FROM 2908175 GB:TO 2908780 GB:DIRECTION - GB:PRODUCT non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family GB:NOTE TIGRFAM: non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family PFAM: Ham1 family protein KEGG: mta:Moth_0520 Ham1-like protein GB:PROTEIN_ID ABO51189.1 GB:DB_XREF GI:134053218 InterPro:IPR002637 LENGTH 201 SQ:AASEQ MKLVLATNNKGKVKELAELLKPCGYQVVSIGEFPGFTEVEEDGNTFADNAIKKALAAAEFTGELALADDSGLEVDALKGAPGVYSARFAGEPKDDTANNAKLLSLLEGVPQDHRTARFRCVIAIAEPNGRIHTAEGSCEGVILRELKGEGGFGYDPLFYVPEYKQTFAELDMEKKNSISHRGKALKKAMEILNRLYIHQEV GT:EXON 1|1-201:0| SW:ID NTPA_DESRM SW:DE RecName: Full=Nucleoside-triphosphatase; EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase; Short=NTPase; SW:GN OrderedLocusNames=Dred_2683; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->201|NTPA_DESRM|e-107|100.0|201/201| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 47->58|adnaikkalaaa| BL:PDB:NREP 1 BL:PDB:REP 2->192|2pyuA|5e-40|47.9|188/208| RP:PDB:NREP 1 RP:PDB:REP 1->195|2dvoA|2e-39|36.1|183/185| RP:PFM:NREP 1 RP:PFM:REP 3->192|PF01725|1e-51|55.9|188/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 3->191|PF01725|1.7e-76|58.3|187/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 2->192|1k7kA|6e-60|47.4|190/207|c.51.4.1| HM:SCP:REP 1->195|1k7kA_|1.7e-70|57.2|194/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 1043 OP:NHOMOORG 1002 OP:PATTERN 111-1111111111111-111111-11-11--111111111111111111111111111111111-11 1111111111111111111-111111111111111111111122111111111111111111111111111-1111111111-1111111111111---1111111111111111111111111111111111111111111111111111111111222222111111112222222222221111111111111111111111111112111111111111111111111111111111111111111111211111111212222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-1-------1111111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111----1---1--------11------1111111111111 ----111-111-111-----111-111-------11--------11----1111--1-----11-11-1-1--1-111--11111----121-1111111111112--3----1-----1--1-11-2-111-111-1--1--11--------1-111-11111----1-111----117-11111111---1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 97.0 SQ:SECSTR cEEEEEcccHHHHHHHHHHHGGGTcEEEEEccccGGcccccccccHHHHHHHHHHHHTTTccccEEEEEEEEEEGGGTTTcGGGHHHHHHHTccHHTHHHHHHHHHTTcccEccEEEEEEEEEEEETcTEEEEEEEEEEEEEccccccccccTTGGGEEETTccccGGGccHHHHHHHcHHHHHHHHHHHHHHHH###### PSIPRED cEEEEEEccccHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEccccccccccHHHccccccHHHHHHHHHHHHccccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccccccccEEEEEccccccHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHcc //