[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51193.1
DDBJ      :             putative CoA-substrate-specific enzyme activase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->231 1huxA PDBj 3e-25 34.7 %
:RPS:PDB   2->52 2cgkA PDBj 3e-05 19.6 %
:RPS:PDB   80->220 2ahnA PDBj 3e-21 21.4 %
:RPS:PDB   197->249 3b63L PDBj 2e-04 24.5 %
:RPS:SCOP  2->249 1huxA  c.55.1.5 * 3e-26 29.7 %
:HMM:SCOP  1->251 1huxA_ c.55.1.5 * 1.1e-27 25.5 %
:RPS:PFM   4->244 PF01869 * BcrAD_BadFG 6e-22 34.4 %
:HMM:PFM   4->249 PF01869 * BcrAD_BadFG 6.1e-42 35.9 245/268  
:BLT:SWISS 1->250 Y004_METJA 4e-33 36.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51193.1 GT:GENE ABO51193.1 GT:PRODUCT putative CoA-substrate-specific enzyme activase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2911486..2912241) GB:FROM 2911486 GB:TO 2912241 GB:DIRECTION - GB:PRODUCT putative CoA-substrate-specific enzyme activase GB:NOTE TIGRFAM: putative CoA-substrate-specific enzyme activase PFAM: ATPase, BadF/BadG/BcrA/BcrD type KEGG: chy:CHY_0311 putative CoA-substrate-specific enzyme activase GB:PROTEIN_ID ABO51193.1 GB:DB_XREF GI:134053222 InterPro:IPR002731 InterPro:IPR008275 LENGTH 251 SQ:AASEQ MICGIDLGSRNVKVALMDKDGGLSFRKFDTVSFYRKHGKSVNGELLVDLEALGIGLPEKIVATGYGRQTINLKGADILPEIKAHVLGAIHQTGLSEFTLLDLGGQDSKVVLVSKGRMMDFQTNDKCAASTGRYLENMAAVLDIDMDELAYYDENPVDLNSTCAIFGETELIGKVVEGHPISALGAGVNYTIFKRIKPMLSKLLTDTIVFTGGVAHSQALVKIIENEMKVPVVVPQHPQYNGAIGCCAFALG GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 1->250|Y004_METJA|4e-33|36.6|238/243| BL:PDB:NREP 1 BL:PDB:REP 61->231|1huxA|3e-25|34.7|170/259| RP:PDB:NREP 3 RP:PDB:REP 2->52|2cgkA|3e-05|19.6|51/478| RP:PDB:REP 80->220|2ahnA|3e-21|21.4|140/222| RP:PDB:REP 197->249|3b63L|2e-04|24.5|53/365| RP:PFM:NREP 1 RP:PFM:REP 4->244|PF01869|6e-22|34.4|241/266|BcrAD_BadFG| HM:PFM:NREP 1 HM:PFM:REP 4->249|PF01869|6.1e-42|35.9|245/268|BcrAD_BadFG| RP:SCP:NREP 1 RP:SCP:REP 2->249|1huxA|3e-26|29.7|246/259|c.55.1.5| HM:SCP:REP 1->251|1huxA_|1.1e-27|25.5|247/0|c.55.1.5|1/1|Actin-like ATPase domain| OP:NHOMO 389 OP:NHOMOORG 184 OP:PATTERN -----------------------1--------1112222222223212111112-------------- --1------------------------------------------------------------1-------11111111333-1------1--------------------------------------------------111--------------------------------------------111----------------------------------111111----------------------1----------------------111--------11----------------------------------3433388788882822333411112312-223279444623653333-2--2------------------232-2----------------------------------------------------------------2---------------------------------------------------------------------------------------------------------4---A361-12213111-322313311-----122-12---------1-------11--1--1---------------------------------11-------1------1111111111-11-111-111111111111111-----------------------11-------------------------------------------------------------------------------------------------------------------------1--------------2----------------------------2---12111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR cEEEEEEccccEEEEEEcTTccEEEEEEEccccHHHHcHHHHHHHHHHHHHHHTcccHHHHTTccccccHHHHHHHHHcccccTTccccccccEEEEEEccTTcEEEEEEEcTTcccccEEEEEEccccccccEEEcccGGGGccGGGEcTTccEEEEccHHHHHccHHHHccTTcccTHTTccccHHHHHHHHHcTTccccTTcTTccEEEcccEEEEEHHHHHcTTEEEEEGGGGTccTTHHHHHHHHT DISOP:02AL 174-174| PSIPRED cEEEEEEcccEEEEEEEEcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEHHHHHHHHcccccEEEEEEccccEEEEEEEccEEEEEEEccEEcccccHHHHHHHHHHcccHHHHHHccccccccccEEEEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcEEEccHHHHHHHHHHHccEEEEccccccccHHHHHHHHcc //