[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51198.1
DDBJ      :             glutamate mutase subunit S
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.6
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->134 1be1A PDBj 5e-50 69.8 %
:RPS:PDB   1->135 3bicA PDBj 6e-13 24.0 %
:RPS:SCOP  9->118 1cb7A  c.23.6.1 * 9e-04 70.0 %
:HMM:SCOP  3->138 7reqA2 c.23.6.1 * 9.1e-33 35.4 %
:RPS:PFM   11->67 PF02310 * B12-binding 3e-07 36.8 %
:HMM:PFM   10->99 PF02310 * B12-binding 4e-15 25.0 88/121  
:BLT:SWISS 9->137 MAMA_DESHY 2e-57 79.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51198.1 GT:GENE ABO51198.1 GT:PRODUCT glutamate mutase subunit S GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2917635..2918069) GB:FROM 2917635 GB:TO 2918069 GB:DIRECTION - GB:PRODUCT glutamate mutase subunit S GB:NOTE KEGG: dsy:DSY3236 hypothetical protein TIGRFAM: methylaspartate mutase, S subunit PFAM: cobalamin B12-binding domain protein GB:PROTEIN_ID ABO51198.1 GB:DB_XREF GI:134053227 InterPro:IPR006158 InterPro:IPR006394 LENGTH 144 SQ:AASEQ MVEEKKQLTLVLGVIGADVHAVGNRILEYAFTEAGFKVVNIGVMASQEEFINAAVETNANAILVSSLYGHGEIDCRGLREKAVEAGIGDIKLYVGGNLVVGKQDWQAVEKKFLAMGFDRAYPPGTMPQEAIDDLLMDFGFVQKC GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 9->137|MAMA_DESHY|2e-57|79.1|129/136| BL:PDB:NREP 1 BL:PDB:REP 4->134|1be1A|5e-50|69.8|129/137| RP:PDB:NREP 1 RP:PDB:REP 1->135|3bicA|6e-13|24.0|129/715| RP:PFM:NREP 1 RP:PFM:REP 11->67|PF02310|3e-07|36.8|57/117|B12-binding| HM:PFM:NREP 1 HM:PFM:REP 10->99|PF02310|4e-15|25.0|88/121|B12-binding| GO:PFM:NREP 2 GO:PFM GO:0031419|"GO:cobalamin binding"|PF02310|IPR006158| GO:PFM GO:0046872|"GO:metal ion binding"|PF02310|IPR006158| RP:SCP:NREP 1 RP:SCP:REP 9->118|1cb7A|9e-04|70.0|110/137|c.23.6.1| HM:SCP:REP 3->138|7reqA2|9.1e-33|35.4|130/168|c.23.6.1|1/1|Cobalamin (vitamin B12)-binding domain| OP:NHOMO 49 OP:NHOMOORG 45 OP:PATTERN ------------------------2111---------------------------------------- ----1-----------------------------------------------------------1--------------------1-------------------1----------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------11---------------------1--------22-11-2-1---1--1------------------11-----1------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1-11---------------------------------------------1-------11--------1---11--1-1-1-----1---------1-----------------1------1---------------------------------------------------------------------------------------------------------------------------------1---------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 95.1 SQ:SECSTR HHHHccccEEEEEEcccccccHHHHHHHHHHHHTTcEEEEccTTccHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHTcTTcEEEEEEccccccccGGGHHHHHHHHTccEEEcTTccHHHHHHHHHHH####### DISOP:02AL 1-5,8-9| PSIPRED ccccccccEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccEEEEEHHHcccHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccc //